(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIF

CP001389.FLIF        Location/Qualifiers
FT   CDS             302190..303869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="NGR_c02610"
FT                   /product="flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24059"
FT                   /db_xref="GOA:C3MG08"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG08"
FT                   /protein_id="ACP24059.1"
FT                   /translation="MNLFDQFSTFTKNLSNLGQSKLIALAVAGIVAIGFVLGAAIYVNK
FT                   PAYETLYVGLERSDVTQISIALAEANLDFEVGSDGGSIQVPVGMTGKARLLLAERGLPS
FT                   SANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSF
FT                   RKAEQTPTASVMIRASATVGRGAASSIRHLVASSVPGLDIDDVTILDSTGQLLASGDDP
FT                   ANSALNQSLGVVQNVQTDLEKKIDNALAPFLGMDNFRTSVTASLNTDAQQIQETVFDPE
FT                   SRVERSTRVIKEEQKSSQQQPDNAATVQQNVPQAAPRGGAGQQSNDEAAKKEEQTNYEI
FT                   NSKTIATVKNSYSIERLSIAVVVNRGRLAAMVGEGADQAKIDAYLQDMQKIVASAAGVD
FT                   TNRGDVVTLNAMDFVETQLLDQAVAGPGVMEMLTRNLGGIINSLAFILVAFLVVWLGMR
FT                   PLARQMGFGGQSGHLEGEGAGLELPDFSPAGASAAGGALMEGFGSDFGFDSTDDLLNIS
FT                   DEGNGFNRRVKEGPERRLARMVEISEERAAKILRKWSLDRAA"
     MNLFDQFSTF TKNLSNLGQS KLIALAVAGI VAIGFVLGAA IYVNKPAYET LYVGLERSDV        60
     TQISIALAEA NLDFEVGSDG GSIQVPVGMT GKARLLLAER GLPSSANAGY ELFDNVGSLG       120
     LTSFMQEVTR VRALEGEIAR TIQQISGIAA ARVHIVMPER GSFRKAEQTP TASVMIRASA       180
     TVGRGAASSI RHLVASSVPG LDIDDVTILD STGQLLASGD DPANSALNQS LGVVQNVQTD       240
     LEKKIDNALA PFLGMDNFRT SVTASLNTDA QQIQETVFDP ESRVERSTRV IKEEQKSSQQ       300
     QPDNAATVQQ NVPQAAPRGG AGQQSNDEAA KKEEQTNYEI NSKTIATVKN SYSIERLSIA       360
     VVVNRGRLAA MVGEGADQAK IDAYLQDMQK IVASAAGVDT NRGDVVTLNA MDFVETQLLD       420
     QAVAGPGVME MLTRNLGGII NSLAFILVAF LVVWLGMRPL ARQMGFGGQS GHLEGEGAGL       480
     ELPDFSPAGA SAAGGALMEG FGSDFGFDST DDLLNISDEG NGFNRRVKEG PERRLARMVE       540
     ISEERAAKIL RKWSLDRAA                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page