(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIG

CP001389.FLIG        Location/Qualifiers
FT   CDS             complement(308092..309123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="NGR_c02660"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24064"
FT                   /db_xref="GOA:C3MG13"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG13"
FT                   /protein_id="ACP24064.1"
FT                   /translation="MMDFDGFEAQALATPLSQTEKAAAVLLAMGKSVAGKLLKFFTQSE
FT                   LQAIIAAAQSLRAIPPHELEALVNEFEDLFTEGAGLMDNAKAMESILEEGLTPDEVDGL
FT                   LGRRATFQSYEASIWDRLQECDPAAVAQSLAEEHPQTIAYVLSMMPSSFGAKVLLQLSD
FT                   RLRPDILNRAVNMKSVSPRAASIIEARVIEMIEEMEAERNSPGPAKIAEVMNELEKKQV
FT                   DTLLASLETISTDSAKKVRPKIFLFDDILYMPQRSRVQLFNDVSTDVITMALRGSGPEL
FT                   RESVLASVGARQRRIIESDLAVGDAGINPRDIAIARRSITQEAIRLAASGQLELKEKES
FT                   EAA"
     MMDFDGFEAQ ALATPLSQTE KAAAVLLAMG KSVAGKLLKF FTQSELQAII AAAQSLRAIP        60
     PHELEALVNE FEDLFTEGAG LMDNAKAMES ILEEGLTPDE VDGLLGRRAT FQSYEASIWD       120
     RLQECDPAAV AQSLAEEHPQ TIAYVLSMMP SSFGAKVLLQ LSDRLRPDIL NRAVNMKSVS       180
     PRAASIIEAR VIEMIEEMEA ERNSPGPAKI AEVMNELEKK QVDTLLASLE TISTDSAKKV       240
     RPKIFLFDDI LYMPQRSRVQ LFNDVSTDVI TMALRGSGPE LRESVLASVG ARQRRIIESD       300
     LAVGDAGINP RDIAIARRSI TQEAIRLAAS GQLELKEKES EAA                         343
//

If you have problems or comments...

PBIL Back to PBIL home page