(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIM

CP001389.FLIM        Location/Qualifiers
FT   CDS             complement(309804..310751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="NGR_c02680"
FT                   /product="Flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24066"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG15"
FT                   /protein_id="ACP24066.1"
FT                   /translation="MNPSTDSNVYAFDKKLLARMTGALGDDKTIGRTALELGHVFSERL
FT                   PEMLKQETGRDIAIGYAGVKMGFRNELIADLGEAVLLSDVSLRNWCAEFQIGCDSPVLI
FT                   ALVEALLGAEPIDIEEPLPRALSKIEIDVAVPVFERIAEAVRMAVDAPGGFEPVVGRPH
FT                   NGAERLPPDPALEDVYAASIDMTFGLGPVLSTFSVIIPQNVLLKTQIVPPGNAGRNESM
FT                   KTDWSEQLEEQIRRSAVTLEARIQLESLTLDTISRLQPGDVIPFHDGQDVRVEVNANGR
FT                   DLYVCEFGRSGSRYTVRVKDTHGSEQDILRHIMS"
     MNPSTDSNVY AFDKKLLARM TGALGDDKTI GRTALELGHV FSERLPEMLK QETGRDIAIG        60
     YAGVKMGFRN ELIADLGEAV LLSDVSLRNW CAEFQIGCDS PVLIALVEAL LGAEPIDIEE       120
     PLPRALSKIE IDVAVPVFER IAEAVRMAVD APGGFEPVVG RPHNGAERLP PDPALEDVYA       180
     ASIDMTFGLG PVLSTFSVII PQNVLLKTQI VPPGNAGRNE SMKTDWSEQL EEQIRRSAVT       240
     LEARIQLESL TLDTISRLQP GDVIPFHDGQ DVRVEVNANG RDLYVCEFGR SGSRYTVRVK       300
     DTHGSEQDIL RHIMS                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page