(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIN

CP001389.FLIN        Location/Qualifiers
FT   CDS             complement(309152..309784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="NGR_c02670"
FT                   /product="predicted flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24065"
FT                   /db_xref="GOA:C3MG14"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG14"
FT                   /protein_id="ACP24065.1"
FT                   /translation="MPEASFNWNNPHMVRKKAASIEEQAAFAGDAELDQAIDDLRGVLK
FT                   QDGAATDFGAEFGAAEPFGQGADFGGGLGAGGFGGDFADTSLDGGLDVGTGFAGSDFGG
FT                   SDFGGGDFGAVSSGIETAPGSGMAANMDLIMDIPIDVQIVLGTSRMQVSGLMGLTEGAT
FT                   IALDRKIGEPVEIMVNGRVIGRGEITVLEGDVTRFGVKLIEIKGSRK"
     MPEASFNWNN PHMVRKKAAS IEEQAAFAGD AELDQAIDDL RGVLKQDGAA TDFGAEFGAA        60
     EPFGQGADFG GGLGAGGFGG DFADTSLDGG LDVGTGFAGS DFGGSDFGGG DFGAVSSGIE       120
     TAPGSGMAAN MDLIMDIPID VQIVLGTSRM QVSGLMGLTE GATIALDRKI GEPVEIMVNG       180
     RVIGRGEITV LEGDVTRFGV KLIEIKGSRK                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page