(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIP

CP001389.FLIP        Location/Qualifiers
FT   CDS             321007..321744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="NGR_c02830"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24081"
FT                   /db_xref="GOA:C3MG30"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG30"
FT                   /protein_id="ACP24081.1"
FT                   /translation="MLRIAAFIVAMMAMSGIAGAQSFPADILNTPVDGSVASWIIRTFG
FT                   LLTVLSVAPGILIMVTSFPRFVIAFAILRSGMGLATTPSNMIMVSLALFMTFYVMAPTF
FT                   DRAWREGIDPLLKNEISETEALPRVSEPFREFMLANTRDKDLQLFIDIAREKGQTVVVD
FT                   DKVDLRAVVPAFMISEIRRGFEIGFLIMLPFLVIDLIVSTITMAMGMMMLPPTSISLPF
FT                   KILFFVLIDGWNLLVGSLVRSFT"
     MLRIAAFIVA MMAMSGIAGA QSFPADILNT PVDGSVASWI IRTFGLLTVL SVAPGILIMV        60
     TSFPRFVIAF AILRSGMGLA TTPSNMIMVS LALFMTFYVM APTFDRAWRE GIDPLLKNEI       120
     SETEALPRVS EPFREFMLAN TRDKDLQLFI DIAREKGQTV VVDDKVDLRA VVPAFMISEI       180
     RRGFEIGFLI MLPFLVIDLI VSTITMAMGM MMLPPTSISL PFKILFFVLI DGWNLLVGSL       240
     VRSFT                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page