(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIQ

CP001389.FLIQ        Location/Qualifiers
FT   CDS             338286..338552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="NGR_c03000"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24098"
FT                   /db_xref="GOA:C3MG47"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG47"
FT                   /protein_id="ACP24098.1"
FT                   /translation="MNEADALDIVQAAIWTVIVASGPAVLAAMVVGVVIAFIQALTQVQ
FT                   EMTLTFVPKILAVMVTAAISAPFVGAQISIFTDIIFSRIQSGF"
     MNEADALDIV QAAIWTVIVA SGPAVLAAMV VGVVIAFIQA LTQVQEMTLT FVPKILAVMV        60
     TAAISAPFVG AQISIFTDII FSRIQSGF                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page