(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIR

CP001389.FLIR        Location/Qualifiers
FT   CDS             340750..341502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="NGR_c03020"
FT                   /product="flagellar biosynthesis protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24100"
FT                   /db_xref="GOA:C3MG49"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG49"
FT                   /protein_id="ACP24100.1"
FT                   /translation="MITDPEGTVLALFAAFCRIGGCIMIMPGFSTARVPMQVRLFIAVA
FT                   LSMAILPIMWTDIYPQVAGKGHTYIYLIATESVIGAVIGLVARYYVLGLQFAGTAITML
FT                   IGFNPPPATDVLEETAENQLTSMISFAGLMLLFMLDFHHVIFEAIAQSYRVMPIGIGFD
FT                   PQGMLITLTNSLGQTFLIMLRLASPFVIYGLLFNVAIGMVNRLAPQVPVYFISQPYLIL
FT                   GGLFLLYLGIAAMLRLFADGFAPVMQGG"
     MITDPEGTVL ALFAAFCRIG GCIMIMPGFS TARVPMQVRL FIAVALSMAI LPIMWTDIYP        60
     QVAGKGHTYI YLIATESVIG AVIGLVARYY VLGLQFAGTA ITMLIGFNPP PATDVLEETA       120
     ENQLTSMISF AGLMLLFMLD FHHVIFEAIA QSYRVMPIGI GFDPQGMLIT LTNSLGQTFL       180
     IMLRLASPFV IYGLLFNVAI GMVNRLAPQV PVYFISQPYL ILGGLFLLYL GIAAMLRLFA       240
     DGFAPVMQGG                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page