(data stored in ACNUC7421 zone)

EMBL: CP001389.FOLD2

CP001389.FOLD2       Location/Qualifiers
FT   CDS             345059..345958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD2"
FT                   /locus_tag="NGR_c03080"
FT                   /product="bifunctional protein FolD2; includes:
FT                   Methylenetetrahydrofolatedehydrogenase ;
FT                   Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24106"
FT                   /db_xref="GOA:C3MGJ1"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ1"
FT                   /protein_id="ACP24106.1"
FT                   /translation="MTTVIDGKAVAASVIETVKSATQTLETETGVRAGLAVVIVGDDPA
FT                   SHAYVSAKSRMAKECGFLSVQHTLPGETSQEELAALVAELNADPSIHGILVQLPLPKHL
FT                   QSEPIIQSILPEKDVDGLHVVNAGKVATGDLDGGLVSCTPAGAMVFVRRTHGGDLSGLN
FT                   AVVIGRSNLFGKPMSALLLAANATVTTAHSRTKDLAAVCRNADILVAAVGRPEMVKADW
FT                   VKPGALVIDVGINRVAAPERGEGRTKLVGDVAFEECAKVASVITPVPGGVGPMTIAMLM
FT                   ANTIIAAYRKAGQNPPKF"
     MTTVIDGKAV AASVIETVKS ATQTLETETG VRAGLAVVIV GDDPASHAYV SAKSRMAKEC        60
     GFLSVQHTLP GETSQEELAA LVAELNADPS IHGILVQLPL PKHLQSEPII QSILPEKDVD       120
     GLHVVNAGKV ATGDLDGGLV SCTPAGAMVF VRRTHGGDLS GLNAVVIGRS NLFGKPMSAL       180
     LLAANATVTT AHSRTKDLAA VCRNADILVA AVGRPEMVKA DWVKPGALVI DVGINRVAAP       240
     ERGEGRTKLV GDVAFEECAK VASVITPVPG GVGPMTIAML MANTIIAAYR KAGQNPPKF        299
//

If you have problems or comments...

PBIL Back to PBIL home page