(data stored in ACNUC7421 zone)

EMBL: CP001389.FTSJ

CP001389.FTSJ        Location/Qualifiers
FT   CDS             417309..418046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="NGR_c03730"
FT                   /product="putative ribosomal RNA large subunit
FT                   methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24169"
FT                   /db_xref="GOA:C3MGQ4"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGQ4"
FT                   /protein_id="ACP24169.1"
FT                   /translation="MTKSPIGGNRSGRKLGQKVKKGKLKASSRRWLERHINDPYVQRAQ
FT                   LEGYRARAAFKLLEIDEKHKILAGARRIIDLGAAPGSWSQIAAKVTNSTDADPRVAAID
FT                   FLEMDPIPGVRFLQLDFLDPEAPEKLKEAIGGTPDLVLSDMAAPTTGHRQTDHLRTMHL
FT                   CEVAAHFAVDVLAKGGHFLAKTFQGGTERDLLNMLKQNFSQVIHVKPASSRTESVEMFL
FT                   LAKGFKGRRKAETEEPAEDAAAE"
     MTKSPIGGNR SGRKLGQKVK KGKLKASSRR WLERHINDPY VQRAQLEGYR ARAAFKLLEI        60
     DEKHKILAGA RRIIDLGAAP GSWSQIAAKV TNSTDADPRV AAIDFLEMDP IPGVRFLQLD       120
     FLDPEAPEKL KEAIGGTPDL VLSDMAAPTT GHRQTDHLRT MHLCEVAAHF AVDVLAKGGH       180
     FLAKTFQGGT ERDLLNMLKQ NFSQVIHVKP ASSRTESVEM FLLAKGFKGR RKAETEEPAE       240
     DAAAE                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page