(data stored in ACNUC7421 zone)

EMBL: CP001389.GALE

CP001389.GALE        Location/Qualifiers
FT   CDS             212379..213413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="NGR_c01880"
FT                   /product="UDP-glucose 4-epimerase protein"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23988"
FT                   /db_xref="GOA:C3MFT7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT7"
FT                   /protein_id="ACP23988.1"
FT                   /translation="MAILVTGGAGYIGSHMVWSLLDAGETVVVLDSLTTGFRWAVAPEA
FT                   RFYFGDVGDRAVLARIFAENEIDAVVHFAGSAVVPESVAKPLAYYENNTAKTRMLIAAT
FT                   IEAGVRRFVFSSTAAVYGTQDTPEPVKETAWLRPESPYGRSKLMSEIMLQDAAAAHDFS
FT                   YVALRYFNVAGADPLGRAGQSTFGATHLIKVACEAALGKRRKVDVFGTDYPTADGTGIR
FT                   DYIHVSDLVAAHRNALDYLRRGGEPLVTNCGYGEGFSVLQVLDTVRQVSGCDFRVDYAP
FT                   RRPGDAAQVVADPTVARLKLDWVPTHASLEHIVQSAFDWEGYLSRKNSFDAGRSEDGRL
FT                   VANG"
     MAILVTGGAG YIGSHMVWSL LDAGETVVVL DSLTTGFRWA VAPEARFYFG DVGDRAVLAR        60
     IFAENEIDAV VHFAGSAVVP ESVAKPLAYY ENNTAKTRML IAATIEAGVR RFVFSSTAAV       120
     YGTQDTPEPV KETAWLRPES PYGRSKLMSE IMLQDAAAAH DFSYVALRYF NVAGADPLGR       180
     AGQSTFGATH LIKVACEAAL GKRRKVDVFG TDYPTADGTG IRDYIHVSDL VAAHRNALDY       240
     LRRGGEPLVT NCGYGEGFSV LQVLDTVRQV SGCDFRVDYA PRRPGDAAQV VADPTVARLK       300
     LDWVPTHASL EHIVQSAFDW EGYLSRKNSF DAGRSEDGRL VANG                        344
//

If you have problems or comments...

PBIL Back to PBIL home page