(data stored in ACNUC7421 zone)

EMBL: CP001389.GLCD2

CP001389.GLCD2       Location/Qualifiers
FT   CDS             438119..439558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD2"
FT                   /locus_tag="NGR_c03920"
FT                   /product="glycolate oxidase, subunit GlcD"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24188"
FT                   /db_xref="GOA:C3MGS3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS3"
FT                   /protein_id="ACP24188.1"
FT                   /translation="MPETIGFLKPRQAVLDRRPEIIADLADLLPEGCLISDERGLKPFE
FT                   TDAFLAYRRLPLAVVLPETTEQVSAVLKYCSRYGIPVVPRGAGTSLSGGAIPQEDAIVI
FT                   GLSKMSRILDVDLFNRTATVQAGVTNLNISDAVSADGFFYAPDPSSQLACTIGGNIGMN
FT                   SGGAHCLKYGVTTNNLLGVKMVLFDGTVIELGGKALDSSGYDLLGLVCGSEGQLGIVTE
FT                   ATVRLIAKPEGARPVLFGFASSVAAGSCVADIIGSGIIPVAIEFMDKPAIEICEAFAHA
FT                   GYPLDVEALLIVEVEGSEAEMDTMLESIIAIARRHGVMTIKESQSALEAALIWKGRKSA
FT                   FGATGRVADYICMDGTVPLSQLSHVLRRTGEIVASYGLRVANVFHAGDGNMHPLILYNI
FT                   NDPEDAARAEAAGNDILKLCVDAGGCLTGEHGVGIEKRDLMRHQYNKADLDQQMAVRAA
FT                   FDPQWLLNPSKVFPLEGRPAA"
     MPETIGFLKP RQAVLDRRPE IIADLADLLP EGCLISDERG LKPFETDAFL AYRRLPLAVV        60
     LPETTEQVSA VLKYCSRYGI PVVPRGAGTS LSGGAIPQED AIVIGLSKMS RILDVDLFNR       120
     TATVQAGVTN LNISDAVSAD GFFYAPDPSS QLACTIGGNI GMNSGGAHCL KYGVTTNNLL       180
     GVKMVLFDGT VIELGGKALD SSGYDLLGLV CGSEGQLGIV TEATVRLIAK PEGARPVLFG       240
     FASSVAAGSC VADIIGSGII PVAIEFMDKP AIEICEAFAH AGYPLDVEAL LIVEVEGSEA       300
     EMDTMLESII AIARRHGVMT IKESQSALEA ALIWKGRKSA FGATGRVADY ICMDGTVPLS       360
     QLSHVLRRTG EIVASYGLRV ANVFHAGDGN MHPLILYNIN DPEDAARAEA AGNDILKLCV       420
     DAGGCLTGEH GVGIEKRDLM RHQYNKADLD QQMAVRAAFD PQWLLNPSKV FPLEGRPAA        479
//

If you have problems or comments...

PBIL Back to PBIL home page