(data stored in ACNUC7421 zone)

EMBL: CP001389.GLCE2

CP001389.GLCE2       Location/Qualifiers
FT   CDS             439555..440766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE2"
FT                   /locus_tag="NGR_c03930"
FT                   /product="glycolate oxidase, subunit GlcE"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24189"
FT                   /db_xref="GOA:C3MGS4"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS4"
FT                   /protein_id="ACP24189.1"
FT                   /translation="MIVHFEPASEEGIASVVRSAAAERVTLAIVGGGTRSGLGNPVRAD
FT                   RTLSTRRLAGIVAYHPAEMTMSALAGTPLAEVEAALAANGQMLSFEPMDHRPIFGTTGE
FT                   PTIGGVFAANVSGPRRYVAGAARDNLLGVRFVNGRGELIKAGGRVMKNVTGLDLVKLMA
FT                   GSYGTLGILTEVTFKVLPVPPAAATVVVSGLNDAEAAAVMAEAMAQPVEVSGAAHLPES
FT                   VRGRFIDGALPEGAATVLRLEGLAASVEMRAEKLVAALSRFGSRSQLDAGQAKALWAEI
FT                   RNVKPYADGTARPLWRVSVAPSAGHQLVAALRLQTGVDAFYDWQGGLVWLRMEAEAEAE
FT                   LVRRYVGALGGGHATLVRADGEARARAPAFEPQAPAVAQLSERVRATLDPARIFNPGRL
FT                   AAVA"
     MIVHFEPASE EGIASVVRSA AAERVTLAIV GGGTRSGLGN PVRADRTLST RRLAGIVAYH        60
     PAEMTMSALA GTPLAEVEAA LAANGQMLSF EPMDHRPIFG TTGEPTIGGV FAANVSGPRR       120
     YVAGAARDNL LGVRFVNGRG ELIKAGGRVM KNVTGLDLVK LMAGSYGTLG ILTEVTFKVL       180
     PVPPAAATVV VSGLNDAEAA AVMAEAMAQP VEVSGAAHLP ESVRGRFIDG ALPEGAATVL       240
     RLEGLAASVE MRAEKLVAAL SRFGSRSQLD AGQAKALWAE IRNVKPYADG TARPLWRVSV       300
     APSAGHQLVA ALRLQTGVDA FYDWQGGLVW LRMEAEAEAE LVRRYVGALG GGHATLVRAD       360
     GEARARAPAF EPQAPAVAQL SERVRATLDP ARIFNPGRLA AVA                         403
//

If you have problems or comments...

PBIL Back to PBIL home page