(data stored in ACNUC7421 zone)

EMBL: CP001389.GLNA1

CP001389.GLNA1       Location/Qualifiers
FT   CDS             complement(360432..361868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA1"
FT                   /locus_tag="NGR_c03210"
FT                   /product="glutamine synthetase protein"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24119"
FT                   /db_xref="GOA:C3MGK4"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK4"
FT                   /protein_id="ACP24119.1"
FT                   /translation="MSSKRSVGQQTAKVSKSSGVPLALHAPRGVKTWKEAVDWLKIRGI
FT                   EDIECITPDLAGVPRGKMMPTSKFTSNTSLALPSAIYRHTISGEYPEETGQFRYDSRDS
FT                   DIKLVPDLSTISIVPWESDPTAQVICDIVGSQGEQISYTPRNVLKRVLDLYRQKGWKPV
FT                   VAPEIEFYLVAQNDDPDYPLRPPKGRSGRSILGGQGYSIAGINEFDELIDDIYHFSEKQ
FT                   GLEIDTLIHEEGPAQLEINLRHGDPIELADQVFMFKRTIREAALKHGIYATFMAKPMQG
FT                   QPGSAMHIHQSVIDIETGRNIFSSPDGSPSKEFFAFIGGMQHYVPKTLSMMAPYVNSYR
FT                   RLTPDMSAPVNTAWGYDNRTTAFRIPVSDPVARRIENRLPSSDANPYLALAASLGCGYL
FT                   GIMEDLQPTPPSEDTANEGEIDLPRGLLEAISLLESEPSLAEVFSAEFIAIYAGVKRGE
FT                   FETFMQVISPWEREFLLLNV"
     MSSKRSVGQQ TAKVSKSSGV PLALHAPRGV KTWKEAVDWL KIRGIEDIEC ITPDLAGVPR        60
     GKMMPTSKFT SNTSLALPSA IYRHTISGEY PEETGQFRYD SRDSDIKLVP DLSTISIVPW       120
     ESDPTAQVIC DIVGSQGEQI SYTPRNVLKR VLDLYRQKGW KPVVAPEIEF YLVAQNDDPD       180
     YPLRPPKGRS GRSILGGQGY SIAGINEFDE LIDDIYHFSE KQGLEIDTLI HEEGPAQLEI       240
     NLRHGDPIEL ADQVFMFKRT IREAALKHGI YATFMAKPMQ GQPGSAMHIH QSVIDIETGR       300
     NIFSSPDGSP SKEFFAFIGG MQHYVPKTLS MMAPYVNSYR RLTPDMSAPV NTAWGYDNRT       360
     TAFRIPVSDP VARRIENRLP SSDANPYLAL AASLGCGYLG IMEDLQPTPP SEDTANEGEI       420
     DLPRGLLEAI SLLESEPSLA EVFSAEFIAI YAGVKRGEFE TFMQVISPWE REFLLLNV         478
//

If you have problems or comments...

PBIL Back to PBIL home page