(data stored in ACNUC7421 zone)

EMBL: CP001389.GLND

CP001389.GLND        Location/Qualifiers
FT   CDS             33204..36101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="NGR_c00320"
FT                   /product="[Protein-PII] uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23836"
FT                   /db_xref="GOA:C3MEZ9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ9"
FT                   /protein_id="ACP23836.1"
FT                   /translation="MQRTIRSVGQDASRHFMARHETSFPEILDVAALRAKCGFIAAAHA
FT                   EQREPMRRALLAAFKEANNAGRAKARQLLAADGAGIKCAERISWLQDQLITVLHDFMLN
FT                   EVFDAAHAPPAARLAVTAVGGYGRGTLAPGSDIDLLFLLPSKRAVWAEPAIEFMLYVLW
FT                   DLGFKVGHATRTIDECIRLSRADMTIRTAILECRYICGSEALAGELEQRFDHEIVRNTG
FT                   PEFIAAKLAERDGRHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWIAKYFYRVKDPADLV
FT                   KLAVLSRQEYKLFQKSDDFLWAVRCHMHFLTGKAEERLSFDIQREIAEALGYHDHPGLS
FT                   AVERFMKHYFLVAKDVGDLTRIFCAALEDQQAKDTPGISGVFSRFKHRTRKIAGTLDFV
FT                   DDGGRIALASPDVFKREPINLLRLFHIADIHGLEFHPNALKQVTRSLGLITPHLRENDE
FT                   ANRLFLSILTSRRNPELILRRMNEAGVLGRFIPDFGKIVSMMQFNMYHHYTVDEHLLRT
FT                   VDVLSRIDRGLEEEAHPLTAMLMPGIEDRSALYVAVLLHDIAKGRPEDHSVAGAKVARK
FT                   LCPRLGLSPKQTETVVWLVEEHLTMSMVAQTRDLNDRKTILDFAERVQSLDRLKMLLIL
FT                   TVCDIRAVGPGVWNGWKGQLLRTLYYETELLLSGGFSELSRKERAKHAAHMLSDALKDW
FT                   SKKERDAYVRLHYQPYLLTVALEDQVRHAEFIREADRAGKTLATMVRTHHFHAITEITV
FT                   LSPDHPRLLTVIAGACAAAGANIVDAQIHTTSDGRALDTILVNREFSVDEDEMRRAASI
FT                   GKLIEDVLSGRKRLPEVIASRTRAKKRSKAFTVTPEVTISNTLSNKFTVIEVEGLDRTG
FT                   LLSEITAVLSDLSLDIASAHITTFGEKVIDTFYVTDLVGAKITNENRQGNIAARLKAVL
FT                   AGEVDEARERMPSGIIAPAHSPRSSHAARTTKVET"
     MQRTIRSVGQ DASRHFMARH ETSFPEILDV AALRAKCGFI AAAHAEQREP MRRALLAAFK        60
     EANNAGRAKA RQLLAADGAG IKCAERISWL QDQLITVLHD FMLNEVFDAA HAPPAARLAV       120
     TAVGGYGRGT LAPGSDIDLL FLLPSKRAVW AEPAIEFMLY VLWDLGFKVG HATRTIDECI       180
     RLSRADMTIR TAILECRYIC GSEALAGELE QRFDHEIVRN TGPEFIAAKL AERDGRHRKA       240
     GDTRYLVEPN VKEGKGGLRD LHTLFWIAKY FYRVKDPADL VKLAVLSRQE YKLFQKSDDF       300
     LWAVRCHMHF LTGKAEERLS FDIQREIAEA LGYHDHPGLS AVERFMKHYF LVAKDVGDLT       360
     RIFCAALEDQ QAKDTPGISG VFSRFKHRTR KIAGTLDFVD DGGRIALASP DVFKREPINL       420
     LRLFHIADIH GLEFHPNALK QVTRSLGLIT PHLRENDEAN RLFLSILTSR RNPELILRRM       480
     NEAGVLGRFI PDFGKIVSMM QFNMYHHYTV DEHLLRTVDV LSRIDRGLEE EAHPLTAMLM       540
     PGIEDRSALY VAVLLHDIAK GRPEDHSVAG AKVARKLCPR LGLSPKQTET VVWLVEEHLT       600
     MSMVAQTRDL NDRKTILDFA ERVQSLDRLK MLLILTVCDI RAVGPGVWNG WKGQLLRTLY       660
     YETELLLSGG FSELSRKERA KHAAHMLSDA LKDWSKKERD AYVRLHYQPY LLTVALEDQV       720
     RHAEFIREAD RAGKTLATMV RTHHFHAITE ITVLSPDHPR LLTVIAGACA AAGANIVDAQ       780
     IHTTSDGRAL DTILVNREFS VDEDEMRRAA SIGKLIEDVL SGRKRLPEVI ASRTRAKKRS       840
     KAFTVTPEVT ISNTLSNKFT VIEVEGLDRT GLLSEITAVL SDLSLDIASA HITTFGEKVI       900
     DTFYVTDLVG AKITNENRQG NIAARLKAVL AGEVDEARER MPSGIIAPAH SPRSSHAART       960
     TKVET                                                                   965
//

If you have problems or comments...

PBIL Back to PBIL home page