(data stored in ACNUC7421 zone)

EMBL: CP001389.GROEL1

CP001389.GROEL1      Location/Qualifiers
FT   CDS             complement(456136..457773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL1"
FT                   /locus_tag="NGR_c04080"
FT                   /product="60 kDa chaperonin 2"
FT                   /note="protein Cpn60 2; GroEL protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24204"
FT                   /db_xref="GOA:C3MGT9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT9"
FT                   /protein_id="ACP24204.1"
FT                   /translation="MAAKEVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFG
FT                   APRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGA
FT                   KAVAAGMNPMDLKRGIDLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILL
FT                   HEKKLSNLQAMLPVLEAVVQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEDLGIKLENVTLDMLGRAKKVSISKENTTIVDGAGQKA
FT                   DIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRIDDA
FT                   LNATRAAVQEGIVPGGGVALLRSSVKITAKGENDDQDAGVNIVRRALQAPARQIAENAG
FT                   DEASIVVGKILEKNTDDFGYNAQTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITT
FT                   EAMIAELPKKDAPAMPGGMGGMGGMDMM"
     MAAKEVKFGR TAREKMLRGV DILADAVKVT LGPKGRNVVI DKSFGAPRIT KDGVSVAKEI        60
     ELEDKFENMG AQMVREVASK TNDIAGDGTT TATVLAQAIV REGAKAVAAG MNPMDLKRGI       120
     DLAVAEVVKD LLAKAKKINT SDEVAQVGTI SANGEKQIGL DIAEAMQKVG NEGVITVEEA       180
     KTAETELEVV EGMQFDRGYL SPYFVTNPEK MVADLEDAFI LLHEKKLSNL QAMLPVLEAV       240
     VQTGKPLLII AEDVEGEALA TLVVNKLRGG LKIAAVKAPG FGDRRKAMLE DIAILTGGTV       300
     ISEDLGIKLE NVTLDMLGRA KKVSISKENT TIVDGAGQKA DIEGRVAQIK AQIEETTSDY       360
     DREKLQERLA KLAGGVAVIR VGGATEIEVK EKKDRIDDAL NATRAAVQEG IVPGGGVALL       420
     RSSVKITAKG ENDDQDAGVN IVRRALQAPA RQIAENAGDE ASIVVGKILE KNTDDFGYNA       480
     QTGEYGDMIA MGIIDPVKVV RTALQDAASV ASLLITTEAM IAELPKKDAP AMPGGMGGMG       540
     GMDMM                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page