(data stored in ACNUC7421 zone)

EMBL: CP001389.HSLO

CP001389.HSLO        Location/Qualifiers
FT   CDS             173663..174658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="NGR_c01530"
FT                   /product="Hsp33 protein"
FT                   /note="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23955"
FT                   /db_xref="GOA:C3MFB8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB8"
FT                   /protein_id="ACP23955.1"
FT                   /translation="MTETAPGLGEFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAILE
FT                   RHSYPLPVARLVAETVVLAVLLGTSLKFEGKLIVQTQGDGPVDLVVADFSTPDRVRAYA
FT                   RYDEEALAAAEKGGRTQPHELLGNGILAFTIDQGVHTQRYQGIVALDGATLEEIAAVYF
FT                   RQSEQIPTKVRLAVAELLDRDENGKPRHRWRAGGMVAQFLPEAPERMRQPDLPGGDGDD
FT                   GDSSLLFDEDDLWAEAKVMVETIDIDELTDPTVGTERLLYRLFHERGVRVYQPQAVYDR
FT                   CSCSRDKIREVLEGLSDEDIEHSIEDGQIKVTCEFCSTNYRFEASEVRSQ"
     MTETAPGLGE FDFAGDDHVV PFQVEGLDVR GRAVQLGPML DAILERHSYP LPVARLVAET        60
     VVLAVLLGTS LKFEGKLIVQ TQGDGPVDLV VADFSTPDRV RAYARYDEEA LAAAEKGGRT       120
     QPHELLGNGI LAFTIDQGVH TQRYQGIVAL DGATLEEIAA VYFRQSEQIP TKVRLAVAEL       180
     LDRDENGKPR HRWRAGGMVA QFLPEAPERM RQPDLPGGDG DDGDSSLLFD EDDLWAEAKV       240
     MVETIDIDEL TDPTVGTERL LYRLFHERGV RVYQPQAVYD RCSCSRDKIR EVLEGLSDED       300
     IEHSIEDGQI KVTCEFCSTN YRFEASEVRS Q                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page