(data stored in ACNUC7421 zone)

EMBL: CP001389.HSPH

CP001389.HSPH        Location/Qualifiers
FT   CDS             complement(53382..53813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspH"
FT                   /locus_tag="NGR_c00510"
FT                   /product="small heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23855"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF18"
FT                   /protein_id="ACP23855.1"
FT                   /translation="MSRITPFTSPLLVGFDSMEKTLERIAKANDGYPPYNIERIRGDSA
FT                   AGTPERLRITLAVAGFSDEDLEVTTEENQLVIRGRQVETGERDYLHRGIAARQFQRTFV
FT                   LADGMRVLGAELRNGLLSVDLVRPEPVRMVKKINISVPE"
     MSRITPFTSP LLVGFDSMEK TLERIAKAND GYPPYNIERI RGDSAAGTPE RLRITLAVAG        60
     FSDEDLEVTT EENQLVIRGR QVETGERDYL HRGIAARQFQ RTFVLADGMR VLGAELRNGL       120
     LSVDLVRPEP VRMVKKINIS VPE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page