(data stored in ACNUC7421 zone)

EMBL: CP001389.ISPE

CP001389.ISPE        Location/Qualifiers
FT   CDS             complement(507667..508635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="NGR_c04560"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="CMK;
FT                   4-(cytidine-5-diphospho)-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24252"
FT                   /db_xref="GOA:C3MHC4"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC4"
FT                   /protein_id="ACP24252.1"
FT                   /translation="MPRRRCRRSPPRRTRNPDSMPADGIAGFALTLAAPAKINLALHVV
FT                   GQRADGHHLLESLVTFAECGDRIAFAPADADHFTVSGPFSRDLPVSADGKSGNLVLRAR
FT                   DLLRRELIGRGAPTTSVHLHLEKNLPIASGIGGGSADAAATLRGLLSLWKAEIAPERLA
FT                   SLALELGADVPMCLDGRPLLARGIGEEIAPLADLPSFAIVLVNPLVAVSTPVIFRMLAE
FT                   KRNPPLALPHGAHTAAAWLAALADMRNDLERPARALEPAVETVSDALQAVRADLVRMSG
FT                   SGATCFGLFDSDEKAGAAAQRISADQPGWYVLATRTAGKRG"
     MPRRRCRRSP PRRTRNPDSM PADGIAGFAL TLAAPAKINL ALHVVGQRAD GHHLLESLVT        60
     FAECGDRIAF APADADHFTV SGPFSRDLPV SADGKSGNLV LRARDLLRRE LIGRGAPTTS       120
     VHLHLEKNLP IASGIGGGSA DAAATLRGLL SLWKAEIAPE RLASLALELG ADVPMCLDGR       180
     PLLARGIGEE IAPLADLPSF AIVLVNPLVA VSTPVIFRML AEKRNPPLAL PHGAHTAAAW       240
     LAALADMRND LERPARALEP AVETVSDALQ AVRADLVRMS GSGATCFGLF DSDEKAGAAA       300
     QRISADQPGW YVLATRTAGK RG                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page