(data stored in ACNUC7421 zone)

EMBL: CP001389.KDTA

CP001389.KDTA        Location/Qualifiers
FT   CDS             475489..476802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="NGR_c04250"
FT                   /product="3-deoxy-D-manno-octulosonic acid transferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24221"
FT                   /db_xref="GOA:C3MGV6"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV6"
FT                   /protein_id="ACP24221.1"
FT                   /translation="MSSLRARLALSSYRWLGTAIYPFVVPYLAVRAAKGKEDPARRRER
FT                   YGHASAPRPPGPLVWFHAASVGETVAVTPLIKEIRRRGIAVVLTTGTTTSARVAAERLG
FT                   TAVIHQYVPLDFKPAVSRFLEYWQPDLAIIAESEIWPMTIVELGRRHIPQVLVNGRLSD
FT                   RTFARWKKRPSLADALFENLALVIAQSDVDAERFRTLGALPVMVSGNLKVDTDAPPHDP
FT                   QALRDYSQQIGARKTWAAISTFEGEEEAAGVVHHALKQRNGLLTIVVPRHPERGDAVEA
FT                   ALAAKGLKVARRTRGDRLTPDVDIFLGDTIGEMGLYLRLTEIAFVGRSLFAEGGQNPLE
FT                   PAMLGCAVLSGGNVQNFRETYQMLAKNGSAKIVRDVEMLAKGVNYLLGNDDMRRSMIDA
FT                   GLETVQQMRGALTATMKGLEPYVNPLVVKARLEPRAES"
     MSSLRARLAL SSYRWLGTAI YPFVVPYLAV RAAKGKEDPA RRRERYGHAS APRPPGPLVW        60
     FHAASVGETV AVTPLIKEIR RRGIAVVLTT GTTTSARVAA ERLGTAVIHQ YVPLDFKPAV       120
     SRFLEYWQPD LAIIAESEIW PMTIVELGRR HIPQVLVNGR LSDRTFARWK KRPSLADALF       180
     ENLALVIAQS DVDAERFRTL GALPVMVSGN LKVDTDAPPH DPQALRDYSQ QIGARKTWAA       240
     ISTFEGEEEA AGVVHHALKQ RNGLLTIVVP RHPERGDAVE AALAAKGLKV ARRTRGDRLT       300
     PDVDIFLGDT IGEMGLYLRL TEIAFVGRSL FAEGGQNPLE PAMLGCAVLS GGNVQNFRET       360
     YQMLAKNGSA KIVRDVEMLA KGVNYLLGND DMRRSMIDAG LETVQQMRGA LTATMKGLEP       420
     YVNPLVVKAR LEPRAES                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page