(data stored in ACNUC7421 zone)

EMBL: CP001389.KEFB

CP001389.KEFB        Location/Qualifiers
FT   CDS             complement(470922..472778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="NGR_c04210"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24217"
FT                   /db_xref="GOA:C3MGV2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV2"
FT                   /protein_id="ACP24217.1"
FT                   /translation="MQTTPILYTQALMLLGGAVVAAPLFKRLGLGTILGYLAAGIVIGP
FT                   VAQSITEGEEILHVSELGVVFLLFIIGLELKPSRLWQMRRDIFGLGTAQVLVTGLVLSF
FT                   LIEFFSLLEWRGSVIAGFGLALSSTAFAMQILDENNDTNTRYGQRAFSILLLQDLAIVP
FT                   LLALIPLMATRAPEATTTAFEDFAIAIAAIAALYAAGRYLLNPLFQVIARTGARDVMIA
FT                   AALLVVMGAATMMQLAGLSMAMGAFLAGVLLAESSYRHELEADIEPFRGILQALFFMAV
FT                   GLSLELHVIAENYLLILVAVPVLMAVKSLVLYGICRATGSHHNDAVRISLLLPQGGEFG
FT                   FVLFTAAAIAGVFTQGVGSLLVAIVTLSMALTPVAALLSKRLLREHEELEDEIEEDFEG
FT                   AGADVLMIGFSRFAQIAAQILLAGGRDVTIIDHSAARVRQAATFGFRIYFGDGTRLDVL
FT                   RAAGIEKAKIVAVCTQKKEITDRIISLVQAEYPNARIFARSYDRLHTLELRAMGVEYEL
FT                   RETFESGLLFGRKTIEALGVGGEEALAIMDDIRRRDEARLVLQEAEGITAGRHMLHSEP
FT                   VRPEPLVKPKRDVNHTVETEERILTQLPAANDGRADTLASAD"
     MQTTPILYTQ ALMLLGGAVV AAPLFKRLGL GTILGYLAAG IVIGPVAQSI TEGEEILHVS        60
     ELGVVFLLFI IGLELKPSRL WQMRRDIFGL GTAQVLVTGL VLSFLIEFFS LLEWRGSVIA       120
     GFGLALSSTA FAMQILDENN DTNTRYGQRA FSILLLQDLA IVPLLALIPL MATRAPEATT       180
     TAFEDFAIAI AAIAALYAAG RYLLNPLFQV IARTGARDVM IAAALLVVMG AATMMQLAGL       240
     SMAMGAFLAG VLLAESSYRH ELEADIEPFR GILQALFFMA VGLSLELHVI AENYLLILVA       300
     VPVLMAVKSL VLYGICRATG SHHNDAVRIS LLLPQGGEFG FVLFTAAAIA GVFTQGVGSL       360
     LVAIVTLSMA LTPVAALLSK RLLREHEELE DEIEEDFEGA GADVLMIGFS RFAQIAAQIL       420
     LAGGRDVTII DHSAARVRQA ATFGFRIYFG DGTRLDVLRA AGIEKAKIVA VCTQKKEITD       480
     RIISLVQAEY PNARIFARSY DRLHTLELRA MGVEYELRET FESGLLFGRK TIEALGVGGE       540
     EALAIMDDIR RRDEARLVLQ EAEGITAGRH MLHSEPVRPE PLVKPKRDVN HTVETEERIL       600
     TQLPAANDGR ADTLASAD                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page