(data stored in ACNUC7421 zone)

EMBL: CP001389.KPSF

CP001389.KPSF        Location/Qualifiers
FT   CDS             229334..230344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="NGR_c02040"
FT                   /product="sugar isomerase, KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24004"
FT                   /db_xref="GOA:C3MFV3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV3"
FT                   /protein_id="ACP24004.1"
FT                   /translation="MGLRHVKGEGHSPSAILDSIGRTLTTASNGIKALAEHLATDESFA
FT                   QSLVEAVELVGDGHGRVVVSGVGKSGHIGRKIAATLASTGTSAYFVHPTEASHGDLGMV
FT                   TSDDVLILLSWSGETAELANMLTYAKRFKVPIVSISSNRDSILARNSEIALVLPKVPEA
FT                   CPHGLAPTTSAMLQLAVGDALAIALLERRGFSAEDFKTFHPGGKLGAQLRLVHELAHVA
FT                   DQMPLLVVGRPMSEAVIEMSAKGFGVVGIVDEGGVLVGVITDGDLRRHMAGDLLGQPVE
FT                   EVMSCHPKVIQADVLASAAMEFMQEHKVTVLFLVDETGMPEGILHIHDLLRAGVA"
     MGLRHVKGEG HSPSAILDSI GRTLTTASNG IKALAEHLAT DESFAQSLVE AVELVGDGHG        60
     RVVVSGVGKS GHIGRKIAAT LASTGTSAYF VHPTEASHGD LGMVTSDDVL ILLSWSGETA       120
     ELANMLTYAK RFKVPIVSIS SNRDSILARN SEIALVLPKV PEACPHGLAP TTSAMLQLAV       180
     GDALAIALLE RRGFSAEDFK TFHPGGKLGA QLRLVHELAH VADQMPLLVV GRPMSEAVIE       240
     MSAKGFGVVG IVDEGGVLVG VITDGDLRRH MAGDLLGQPV EEVMSCHPKV IQADVLASAA       300
     MEFMQEHKVT VLFLVDETGM PEGILHIHDL LRAGVA                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page