(data stored in ACNUC7421 zone)

EMBL: CP001389.LPXK

CP001389.LPXK        Location/Qualifiers
FT   CDS             477656..478696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="NGR_c04270"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24223"
FT                   /db_xref="GOA:C3MGV8"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGV8"
FT                   /protein_id="ACP24223.1"
FT                   /translation="MVSEAPPFWWTKADWRAYALWPFAWAYGRVAAIRMDRARRAMPPV
FT                   PLICVGNFTVGGAGKTPTAIALAQAAKARGLKPGFLSRGYGGSLDVTTVVDPGHHRARD
FT                   VGDEPLLLAREALTVVCRRRVDGARRLAAEGADIIIMDDGFQSARLTFDFALLVIDSMR
FT                   GIGNGHLVPSGPVRAPIADQLRHATALLKIGHGPAADRLIRRAARAGKAIYVADTVRLD
FT                   DGSMSGVKVLAWAGIADPEKFYRTVRDAGAIVEETRSFPDHHHFSDDEIADLIDRAASQ
FT                   GYTLVTTAKDMVRLEPGHGRAAELAAKSRVIEIEVRFDDPLAPAKIIDATLAAARARKL
FT                   RANGKG"
     MVSEAPPFWW TKADWRAYAL WPFAWAYGRV AAIRMDRARR AMPPVPLICV GNFTVGGAGK        60
     TPTAIALAQA AKARGLKPGF LSRGYGGSLD VTTVVDPGHH RARDVGDEPL LLAREALTVV       120
     CRRRVDGARR LAAEGADIII MDDGFQSARL TFDFALLVID SMRGIGNGHL VPSGPVRAPI       180
     ADQLRHATAL LKIGHGPAAD RLIRRAARAG KAIYVADTVR LDDGSMSGVK VLAWAGIADP       240
     EKFYRTVRDA GAIVEETRSF PDHHHFSDDE IADLIDRAAS QGYTLVTTAK DMVRLEPGHG       300
     RAAELAAKSR VIEIEVRFDD PLAPAKIIDA TLAAARARKL RANGKG                      346
//

If you have problems or comments...

PBIL Back to PBIL home page