(data stored in ACNUC7421 zone)

EMBL: CP001389.MEXE

CP001389.MEXE        Location/Qualifiers
FT   CDS             complement(68515..69720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexE"
FT                   /locus_tag="NGR_c00630"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23867"
FT                   /db_xref="GOA:C3MF30"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF30"
FT                   /protein_id="ACP23867.1"
FT                   /translation="MTSSVTRRALWGAGLSILLSVAGGGAVLLGLPAHLKADAATEASP
FT                   AAPPAVPVSVAKAETRRITTWESFSGRLEAIERVEVRPRVGGAILSAHFREGALVEKGD
FT                   LLVTIDPEPYAAAVERAEAEVAAAEARVALAKTELDRARKLVSTSAIPQSGVDQRSSAY
FT                   DEAQANVRSAKAALRSARLDLGYTEVRAPIAGRAGRLEVTAGNLVAAGSASPVLTTLVS
FT                   VDPIYASFNVNEEVVAAALAKLSASAGADSIERIPVEIGTAADEGTPISGHIQLINNEV
FT                   DAATGTIRVRAALENPDGRLIPGQFVRIRIGDPAPAEKLVISDRAIGSDQDKKFVLVVG
FT                   SDNKVEYRQVTLGPTSDGMRIVESGLKPGESIVVNGLQRVRPGVVVAPQPAEQATASIA
FT                   KP"
     MTSSVTRRAL WGAGLSILLS VAGGGAVLLG LPAHLKADAA TEASPAAPPA VPVSVAKAET        60
     RRITTWESFS GRLEAIERVE VRPRVGGAIL SAHFREGALV EKGDLLVTID PEPYAAAVER       120
     AEAEVAAAEA RVALAKTELD RARKLVSTSA IPQSGVDQRS SAYDEAQANV RSAKAALRSA       180
     RLDLGYTEVR APIAGRAGRL EVTAGNLVAA GSASPVLTTL VSVDPIYASF NVNEEVVAAA       240
     LAKLSASAGA DSIERIPVEI GTAADEGTPI SGHIQLINNE VDAATGTIRV RAALENPDGR       300
     LIPGQFVRIR IGDPAPAEKL VISDRAIGSD QDKKFVLVVG SDNKVEYRQV TLGPTSDGMR       360
     IVESGLKPGE SIVVNGLQRV RPGVVVAPQP AEQATASIAK P                           401
//

If you have problems or comments...

PBIL Back to PBIL home page