(data stored in ACNUC7421 zone)

EMBL: CP001389.MIAB

CP001389.MIAB        Location/Qualifiers
FT   CDS             43154..44554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="NGR_c00410"
FT                   /product="putative tRNA-i(6)A37 modification enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23845"
FT                   /db_xref="GOA:C3MF08"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF08"
FT                   /protein_id="ACP23845.1"
FT                   /translation="MTQETALLPKSPRAGDEHVPARKVFVKTYGCQMNVYDSDRMSDAL
FT                   SRDGYVATDVLEDADFVLLNTCHIREKAAEKVYSELGRLRELKKAKASEGREMVIGVAG
FT                   CVAQAEGNEILRRAPAVDLVIGPQTYHRLPEALKRARSGERVVETDYAIEDKFEHLPAP
FT                   DKAKTRSRGVTAFLTVQEGCDKFCTFCVVPYTRGAEVSRPVAQILAEAEKLVDGGVREI
FT                   TLLGQNVNAWHGAGPNGRDWGLGDLLRRLGEIDGLARLRYTTSHPRDMDESLIEAHRSM
FT                   AKLMPYLHLPVQSGSDRILKAMNRRHTAAEYLALVERIRAVQPDLALSGDFIVGFPGET
FT                   EADFEETMRLVEVVGYAQAFSFKYSTRPGTPGADLKDQVPEDVKAKRLERLQSLLVNQQ
FT                   RDFAAACVGREIDLLLEKPGRMPGQLVGRSPWLQPVNVDAKRSQIGDIIKVRITKAGSN
FT                   SLFAEMIE"
     MTQETALLPK SPRAGDEHVP ARKVFVKTYG CQMNVYDSDR MSDALSRDGY VATDVLEDAD        60
     FVLLNTCHIR EKAAEKVYSE LGRLRELKKA KASEGREMVI GVAGCVAQAE GNEILRRAPA       120
     VDLVIGPQTY HRLPEALKRA RSGERVVETD YAIEDKFEHL PAPDKAKTRS RGVTAFLTVQ       180
     EGCDKFCTFC VVPYTRGAEV SRPVAQILAE AEKLVDGGVR EITLLGQNVN AWHGAGPNGR       240
     DWGLGDLLRR LGEIDGLARL RYTTSHPRDM DESLIEAHRS MAKLMPYLHL PVQSGSDRIL       300
     KAMNRRHTAA EYLALVERIR AVQPDLALSG DFIVGFPGET EADFEETMRL VEVVGYAQAF       360
     SFKYSTRPGT PGADLKDQVP EDVKAKRLER LQSLLVNQQR DFAAACVGRE IDLLLEKPGR       420
     MPGQLVGRSP WLQPVNVDAK RSQIGDIIKV RITKAGSNSL FAEMIE                      466
//

If you have problems or comments...

PBIL Back to PBIL home page