(data stored in ACNUC7421 zone)

EMBL: CP001389.MOTA

CP001389.MOTA        Location/Qualifiers
FT   CDS             complement(310756..311634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="NGR_c02690"
FT                   /product="chemotaxis protein motility protein A"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24067"
FT                   /db_xref="GOA:C3MG16"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG16"
FT                   /protein_id="ACP24067.1"
FT                   /translation="MNIIIGLLVTFGCILGGYLAMGGHLEVLNQPFELMIIGGAGIGGF
FT                   IMANSMKVVKDTGKALGEAFKHKVPKERHYLDTLGVLYSLMRDLRTKSRNEIESHIDNP
FT                   EESPIFQSAPTVLQNKELTAFICDYVRLIIIGNARSHEIEALMDEEIHTITHDKMKCYH
FT                   ALTSMGDALPAIGIVAAVLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYSIVGP
FT                   LVANIKAVREKQNRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMM
FT                   NPGGGGESKAA"
     MNIIIGLLVT FGCILGGYLA MGGHLEVLNQ PFELMIIGGA GIGGFIMANS MKVVKDTGKA        60
     LGEAFKHKVP KERHYLDTLG VLYSLMRDLR TKSRNEIESH IDNPEESPIF QSAPTVLQNK       120
     ELTAFICDYV RLIIIGNARS HEIEALMDEE IHTITHDKMK CYHALTSMGD ALPAIGIVAA       180
     VLGVIKAMGA ISEAPEVLGA KIAAALVGTL LGVFLSYSIV GPLVANIKAV REKQNRLYVI       240
     VKQTLLAYMN GSVPQVALEY GRKTISAYER PSIDAVEQEM MNPGGGGESK AA               292
//

If you have problems or comments...

PBIL Back to PBIL home page