(data stored in ACNUC7421 zone)

EMBL: CP001389.MOTB

CP001389.MOTB        Location/Qualifiers
FT   CDS             327625..328803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="NGR_c02890"
FT                   /product="chemotaxis protein motility protein B"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24087"
FT                   /db_xref="GOA:C3MG36"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG36"
FT                   /protein_id="ACP24087.1"
FT                   /translation="MSEESHHNGKNEIIIVKRSGDGHDGHHGGGWKIAYADFMTAMMAF
FT                   FLVMWLINAANEETKAAIASYFNPVQLTDQKPAEKGLKNPAKDAQGEETQQRSKSDGEQ
FT                   TKSGGSAKTGDQLTATSGEETKYSDADFFENPYSVLSEIAKEAGQQANISAKGEGGAAQ
FT                   SGPATGAEGGEAYRDPFDPDFWTKQVEVKDAGNATEGDVADADAGNNPAAGEALKTAEA
FT                   RKGEVPLEQEAEAQQQQKEAEALKAEIEKAVGGEAGRLLEGLVVTPSEGGLLVTISEQT
FT                   DAPMFAVGSAVPAKDLVLAMEKIGTLLAERQGAVAIRGHTDGRPFKDGTYDNWRLSAAR
FT                   AQSAYYMLVRGGLKEQRVNQISGFADRRLQVPNDPYAAANRRIEILLQSGQG"
     MSEESHHNGK NEIIIVKRSG DGHDGHHGGG WKIAYADFMT AMMAFFLVMW LINAANEETK        60
     AAIASYFNPV QLTDQKPAEK GLKNPAKDAQ GEETQQRSKS DGEQTKSGGS AKTGDQLTAT       120
     SGEETKYSDA DFFENPYSVL SEIAKEAGQQ ANISAKGEGG AAQSGPATGA EGGEAYRDPF       180
     DPDFWTKQVE VKDAGNATEG DVADADAGNN PAAGEALKTA EARKGEVPLE QEAEAQQQQK       240
     EAEALKAEIE KAVGGEAGRL LEGLVVTPSE GGLLVTISEQ TDAPMFAVGS AVPAKDLVLA       300
     MEKIGTLLAE RQGAVAIRGH TDGRPFKDGT YDNWRLSAAR AQSAYYMLVR GGLKEQRVNQ       360
     ISGFADRRLQ VPNDPYAAAN RRIEILLQSG QG                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page