(data stored in ACNUC7421 zone)

EMBL: CP001389.MOTC

CP001389.MOTC        Location/Qualifiers
FT   CDS             328809..330116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motC"
FT                   /locus_tag="NGR_c02900"
FT                   /product="chemotaxis protein motility protein C"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24088"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG37"
FT                   /protein_id="ACP24088.1"
FT                   /translation="MLKRLGAILATSVLAVPLAIGLARASETEELAPFKMVRSLQYVQD
FT                   SVVLGDHSAIEMQRFMLNKIDKRLRAADEAIFRDPRNVDAALVYVMSGGNPETLDYLTD
FT                   RDVEGNFDARVAEALRQYLRGKGPLIVENLAKAAPEYKNSRVGPYLFLILGNATSQQDP
FT                   VAAMKYYDWARLTAPGTIIEEAALRRSVSLAVQAGDPEKGFRYALNYARRYLTSPYASQ
FT                   FADVFVELAVTHFDETVEKRVAEILAFMDQSRQREVYLRVARRAAIGGNQTLARLASSR
FT                   AEELALDGGGQSQLLASFYDGLAAVPSEDVFTAAQTLAAIPDGKLSRRDRALREAARAI
FT                   AEEVVRLPRDESSAQASMPIPEANTGPAKDGGETGETGSGMSPFAVASDRPPAPGGERP
FT                   ASAETAAASDPALDGFVANGRSKIKEIDALLAEEGL"
     MLKRLGAILA TSVLAVPLAI GLARASETEE LAPFKMVRSL QYVQDSVVLG DHSAIEMQRF        60
     MLNKIDKRLR AADEAIFRDP RNVDAALVYV MSGGNPETLD YLTDRDVEGN FDARVAEALR       120
     QYLRGKGPLI VENLAKAAPE YKNSRVGPYL FLILGNATSQ QDPVAAMKYY DWARLTAPGT       180
     IIEEAALRRS VSLAVQAGDP EKGFRYALNY ARRYLTSPYA SQFADVFVEL AVTHFDETVE       240
     KRVAEILAFM DQSRQREVYL RVARRAAIGG NQTLARLASS RAEELALDGG GQSQLLASFY       300
     DGLAAVPSED VFTAAQTLAA IPDGKLSRRD RALREAARAI AEEVVRLPRD ESSAQASMPI       360
     PEANTGPAKD GGETGETGSG MSPFAVASDR PPAPGGERPA SAETAAASDP ALDGFVANGR       420
     SKIKEIDALL AEEGL                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page