(data stored in ACNUC7421 zone)

EMBL: CP001389.MOTD

CP001389.MOTD        Location/Qualifiers
FT   CDS             330113..331594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motD"
FT                   /locus_tag="NGR_c02910"
FT                   /product="chemotaxis protein motility protein D"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24089"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG38"
FT                   /protein_id="ACP24089.1"
FT                   /translation="MRPLEETFRAPAAAVGARPGSRQGGNEQVAGEPGAFESAVADAGR
FT                   QKTAAQGAAQGSGESAVDSAAEGTQTAAAEFTIGKPKAGVLIASATITGTGRLSTPSAK
FT                   GRGEGDADGALAEGQASSELKSVREKGNRQFSAAQADLEAEEASDPDGKAVTGKPKGHM
FT                   AAQTGAMEYSEAGATPEGDTGSAAPANGPVSDLLSLLGSAPPAAALDTAGGENTSNAAR
FT                   STGGRVAALAAETADVPADADAAEGSRTGEQGDAGSDRLFRFARADGKGQAVSMSISAD
FT                   GEATAVENGRPTANAKAEAVTVLEARRYLGVAMNTNSAAVTGAIAGDGAWAQALQSSAL
FT                   STQPEASSLAGKTLNTLKIQMHPIELGTVTATLRLKDDELQVDLKVETGEAFRQLRDDQ
FT                   SEMVKALRAQGFAVDQVNVVFNAGGDASNGSGSQPQTQGQLGQSAGERTGGDSGQGRQR
FT                   PNGGEAAQAETWWGNDGTDDAAAGVGHSRTGDVYM"
     MRPLEETFRA PAAAVGARPG SRQGGNEQVA GEPGAFESAV ADAGRQKTAA QGAAQGSGES        60
     AVDSAAEGTQ TAAAEFTIGK PKAGVLIASA TITGTGRLST PSAKGRGEGD ADGALAEGQA       120
     SSELKSVREK GNRQFSAAQA DLEAEEASDP DGKAVTGKPK GHMAAQTGAM EYSEAGATPE       180
     GDTGSAAPAN GPVSDLLSLL GSAPPAAALD TAGGENTSNA ARSTGGRVAA LAAETADVPA       240
     DADAAEGSRT GEQGDAGSDR LFRFARADGK GQAVSMSISA DGEATAVENG RPTANAKAEA       300
     VTVLEARRYL GVAMNTNSAA VTGAIAGDGA WAQALQSSAL STQPEASSLA GKTLNTLKIQ       360
     MHPIELGTVT ATLRLKDDEL QVDLKVETGE AFRQLRDDQS EMVKALRAQG FAVDQVNVVF       420
     NAGGDASNGS GSQPQTQGQL GQSAGERTGG DSGQGRQRPN GGEAAQAETW WGNDGTDDAA       480
     AGVGHSRTGD VYM                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page