(data stored in ACNUC7421 zone)

EMBL: CP001389.MUTL

CP001389.MUTL        Location/Qualifiers
FT   CDS             complement(479082..480884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="NGR_c04290"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24225"
FT                   /db_xref="GOA:C3MGW0"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGW0"
FT                   /protein_id="ACP24225.1"
FT                   /translation="MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEVA
FT                   TAGGGKTLLRVTDNGNGMSPADLELAIRRHCTSKIDDTLTDIRTLGFRGEALPSIGSVA
FT                   RLSITTRTAGAREGAAISVIGGKTESVRPSPANVGTVVEVRDLFFATPARLKFMKTEKA
FT                   EAAAISEVVRRMAIAFPKVRFVVSGSDRSTLEFPATGDDRLARMAQVLGKDFRDNAIGI
FT                   DAEREEARLSGFAGVPTFNRGNSLQQYAFVNGRPVQDKLILSAIRAAYAETIPQGRYPV
FT                   AVLSIALDPALVDVNVHPAKSDVRFRDPGLIRGLIIGAIREALSRGGDRAATTGAQGMM
FT                   RSFRPEAYRAEPHRAQAPWTAATSPYRPMRFDEPARGFAEAPQAAFQEFAQPAARPAET
FT                   APNGTVEPAFPLGAARAQLHENYIVAQTEEGLVIVDQHAAHERLVFEAMRTALHSRPVP
FT                   AQALLIPEIVDLAEDDCDRLMAHAEEFLRLGLSIERFGPGAIAVRETPAMLGEMDASGL
FT                   VRQLADELAEWDTANGLAGRLDYLAATMACHGSVRSGRRMRPEEMNALLRQMEATPGSG
FT                   QCNHGRPTYIELKLADIERLFGRS"
     MAIKQLSETL INQIAAGEVI ERPASAAKEL IENALDAGAT RIEVATAGGG KTLLRVTDNG        60
     NGMSPADLEL AIRRHCTSKI DDTLTDIRTL GFRGEALPSI GSVARLSITT RTAGAREGAA       120
     ISVIGGKTES VRPSPANVGT VVEVRDLFFA TPARLKFMKT EKAEAAAISE VVRRMAIAFP       180
     KVRFVVSGSD RSTLEFPATG DDRLARMAQV LGKDFRDNAI GIDAEREEAR LSGFAGVPTF       240
     NRGNSLQQYA FVNGRPVQDK LILSAIRAAY AETIPQGRYP VAVLSIALDP ALVDVNVHPA       300
     KSDVRFRDPG LIRGLIIGAI REALSRGGDR AATTGAQGMM RSFRPEAYRA EPHRAQAPWT       360
     AATSPYRPMR FDEPARGFAE APQAAFQEFA QPAARPAETA PNGTVEPAFP LGAARAQLHE       420
     NYIVAQTEEG LVIVDQHAAH ERLVFEAMRT ALHSRPVPAQ ALLIPEIVDL AEDDCDRLMA       480
     HAEEFLRLGL SIERFGPGAI AVRETPAMLG EMDASGLVRQ LADELAEWDT ANGLAGRLDY       540
     LAATMACHGS VRSGRRMRPE EMNALLRQME ATPGSGQCNH GRPTYIELKL ADIERLFGRS       600
//

If you have problems or comments...

PBIL Back to PBIL home page