(data stored in ACNUC7421 zone)

EMBL: CP001389.MUTS

CP001389.MUTS        Location/Qualifiers
FT   CDS             30127..32928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="NGR_c00310"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23835"
FT                   /db_xref="GOA:C3MEZ8"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ8"
FT                   /protein_id="ACP23835.1"
FT                   /translation="MSSINACGYCDISFFGTIMNFVSDASSRTGDVLSVSDLASEESRS
FT                   TATPMMEQFIEIKANNPDSLLFYRMGDFYELFFQDAVEASRALGITLTKRGQHLGQDIP
FT                   MCGVPVHAADDYLQKLIALGFRVAVCEQVEDPAEAKKRGSKSVVRRDVVRLVTPGTITE
FT                   DKLLSPSESNYLMALARIRSGSEPAYALAWIDISTGIFRLAETAESRLLADILRVEPRE
FT                   LILPDTVFHDPELRPVFDVLGRVAVPQPAVLFDSATAEGRIARYYGVKTLDGFGTFSRA
FT                   ELAAASAAISYVEKTQIQERPALGIPERESAASTLFIDPATRANLELVKTLSGAREGTL
FT                   LRALDRTVTSGGARLLAERLMSPLTDPDRINQRLDSIEVLLDQPSFAIDVRDTLRRAPD
FT                   MPRALSRLALGRGGPRDLGAIQAGLRAAAATATLLSGARLSEELTEAHAAIAALPAALL
FT                   ARLDSMLAEDLPLLKRDGGFLREAASGELDEMRALRDQSRRVIAGLQLQYCEETGIKSL
FT                   KIKHNNVLGYFIEVTAGNAGAMTDTDAGRARFIHRQTMASAMRFTTTELAELETKIANA
FT                   ADRALAIELEAFEAMAREVVADAEAIKAASLALAMLDVSAGLAVLAEEQNYARPAVDRS
FT                   RMFLIDGGRHPVVEQALRRQAGNPFVANGCDLSPPDGPEAGAIWLLTGPNMGGKSTFLR
FT                   QNALIAIMAQMGSFVPANAAHIGIVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQA
FT                   TDHSLVILDEIGRGTATFDGLSIAWAAVEHLHEVNRCRGLFATHFHELTVLSEKLGRLS
FT                   NATMRVKEWDGDVIFLHEVGPGAADRSYGIQVARLAGLPASVVARARDVLANLEDADRK
FT                   NPASQLIDDLPLFQVAVRREEVARASGPSRAEEALRAINPDDMTPREALEALYALKKDL
FT                   AGR"
     MSSINACGYC DISFFGTIMN FVSDASSRTG DVLSVSDLAS EESRSTATPM MEQFIEIKAN        60
     NPDSLLFYRM GDFYELFFQD AVEASRALGI TLTKRGQHLG QDIPMCGVPV HAADDYLQKL       120
     IALGFRVAVC EQVEDPAEAK KRGSKSVVRR DVVRLVTPGT ITEDKLLSPS ESNYLMALAR       180
     IRSGSEPAYA LAWIDISTGI FRLAETAESR LLADILRVEP RELILPDTVF HDPELRPVFD       240
     VLGRVAVPQP AVLFDSATAE GRIARYYGVK TLDGFGTFSR AELAAASAAI SYVEKTQIQE       300
     RPALGIPERE SAASTLFIDP ATRANLELVK TLSGAREGTL LRALDRTVTS GGARLLAERL       360
     MSPLTDPDRI NQRLDSIEVL LDQPSFAIDV RDTLRRAPDM PRALSRLALG RGGPRDLGAI       420
     QAGLRAAAAT ATLLSGARLS EELTEAHAAI AALPAALLAR LDSMLAEDLP LLKRDGGFLR       480
     EAASGELDEM RALRDQSRRV IAGLQLQYCE ETGIKSLKIK HNNVLGYFIE VTAGNAGAMT       540
     DTDAGRARFI HRQTMASAMR FTTTELAELE TKIANAADRA LAIELEAFEA MAREVVADAE       600
     AIKAASLALA MLDVSAGLAV LAEEQNYARP AVDRSRMFLI DGGRHPVVEQ ALRRQAGNPF       660
     VANGCDLSPP DGPEAGAIWL LTGPNMGGKS TFLRQNALIA IMAQMGSFVP ANAAHIGIVD       720
     RLFSRVGASD DLARGRSTFM VEMVETAAIL NQATDHSLVI LDEIGRGTAT FDGLSIAWAA       780
     VEHLHEVNRC RGLFATHFHE LTVLSEKLGR LSNATMRVKE WDGDVIFLHE VGPGAADRSY       840
     GIQVARLAGL PASVVARARD VLANLEDADR KNPASQLIDD LPLFQVAVRR EEVARASGPS       900
     RAEEALRAIN PDDMTPREAL EALYALKKDL AGR                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page