(data stored in ACNUC7421 zone)

EMBL: CP001389.MVIN

CP001389.MVIN        Location/Qualifiers
FT   CDS             36098..37705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="NGR_c00330"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23837"
FT                   /db_xref="GOA:C3MF00"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF00"
FT                   /protein_id="ACP23837.1"
FT                   /translation="MSLVKKFATVGGATLGSRVFGFVRETFMAAALGTGPVADAFNTAF
FT                   RLPNTFRRLFAEGAFNAAFVPLFAKEIEARGMEGARRFSEEVFGVLFTVLLFLTIAMEL
FT                   AMPFIVRELIAPGFADDPAKFASTVTFATIMFPYLACMSLAAMMAGMLNSLHRYFAAAI
FT                   APVFLNVILIGVLAYAWYSGQDPVAVGYGLSWGVMAAGLVQLAIVWIAVRNAGIKIGFR
FT                   RPRLTANVRRLLVLALPAAITGGITQINLLINTNIASAQEGAVSSLVYADRIYQLPLGV
FT                   VGIAVATVLLPELSRALRGGNLNEAANLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLF
FT                   ERGKFSPEATVVVGHILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVS
FT                   LAVTLFPPLGASGIATAEIVAGWVNALLLFTTLLWRGHWGRDIPLLTRVPRLVIAAAIM
FT                   AAALHYAIEWLAFPLSSAAPLAVRAATVCGLVAAAMAIYFASAFGLGGASLGMIRRSLK
FT                   RRAAPAAAPTTGEGPDSP"
     MSLVKKFATV GGATLGSRVF GFVRETFMAA ALGTGPVADA FNTAFRLPNT FRRLFAEGAF        60
     NAAFVPLFAK EIEARGMEGA RRFSEEVFGV LFTVLLFLTI AMELAMPFIV RELIAPGFAD       120
     DPAKFASTVT FATIMFPYLA CMSLAAMMAG MLNSLHRYFA AAIAPVFLNV ILIGVLAYAW       180
     YSGQDPVAVG YGLSWGVMAA GLVQLAIVWI AVRNAGIKIG FRRPRLTANV RRLLVLALPA       240
     AITGGITQIN LLINTNIASA QEGAVSSLVY ADRIYQLPLG VVGIAVATVL LPELSRALRG       300
     GNLNEAANLQ NRSVEFTLFL TLPAAAALLV MSEPIVRLLF ERGKFSPEAT VVVGHILAIY       360
     GLGLPAFVLI KAFIPGFFAR EDTRTPMIFA AISVVVNVSL AVTLFPPLGA SGIATAEIVA       420
     GWVNALLLFT TLLWRGHWGR DIPLLTRVPR LVIAAAIMAA ALHYAIEWLA FPLSSAAPLA       480
     VRAATVCGLV AAAMAIYFAS AFGLGGASLG MIRRSLKRRA APAAAPTTGE GPDSP            535
//

If you have problems or comments...

PBIL Back to PBIL home page