(data stored in ACNUC7421 zone)

EMBL: CP001389.PE101

CP001389.PE101       Location/Qualifiers
FT   CDS             complement(110324..110887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01020"
FT                   /product="hypothetical protein contains Sel1-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23905"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF68"
FT                   /protein_id="ACP23905.1"
FT                   /translation="MDTRINPTIGRANALLLATAVLLSFAAVAAPSAHAADLTAAEQCD
FT                   REAGSELDLERNRAFPAVATQEIRIGVALSACREAYNQSGGARTQFQLARVLDRAGEKL
FT                   KSLQLLGEAAQNGHALAMAMYGIRLVERGEAEAAFDLYQRAAAAGNVVAARNLAVAYRD
FT                   GVGTRADGALAAQWFARAQTSKLQ"
     MDTRINPTIG RANALLLATA VLLSFAAVAA PSAHAADLTA AEQCDREAGS ELDLERNRAF        60
     PAVATQEIRI GVALSACREA YNQSGGARTQ FQLARVLDRA GEKLKSLQLL GEAAQNGHAL       120
     AMAMYGIRLV ERGEAEAAFD LYQRAAAAGN VVAARNLAVA YRDGVGTRAD GALAAQWFAR       180
     AQTSKLQ                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page