(data stored in ACNUC7421 zone)

EMBL: CP001389.PE102

CP001389.PE102       Location/Qualifiers
FT   CDS             111186..111806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23906"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF69"
FT                   /protein_id="ACP23906.1"
FT                   /translation="MPQLHINRRMVLGGLILAVVGCRTATAATGAVVGKAQKIRGNVRR
FT                   RQGDADERLAAGGAVLDRDYVTTSTNSFADLALSETRILLGPQTELLIDSFIAGEGGTL
FT                   ELGVGRMVFDRPQGLPKVDMAIRTAFGMIGVRGTKFFCGPSRAAAFAVFVEHGAVSVEG
FT                   GGIARRLTAGEGVDFDRPGGAPGEVTRWGQARIREAYASVGLR"
     MPQLHINRRM VLGGLILAVV GCRTATAATG AVVGKAQKIR GNVRRRQGDA DERLAAGGAV        60
     LDRDYVTTST NSFADLALSE TRILLGPQTE LLIDSFIAGE GGTLELGVGR MVFDRPQGLP       120
     KVDMAIRTAF GMIGVRGTKF FCGPSRAAAF AVFVEHGAVS VEGGGIARRL TAGEGVDFDR       180
     PGGAPGEVTR WGQARIREAY ASVGLR                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page