(data stored in ACNUC7421 zone)

EMBL: CP001389.PE105

CP001389.PE105       Location/Qualifiers
FT   CDS             114713..115150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01060"
FT                   /product="putative membrane protein contains DoxX family
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23909"
FT                   /db_xref="GOA:C3MF72"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF72"
FT                   /protein_id="ACP23909.1"
FT                   /translation="MPLNVIVLVGRVLLSIMFITSGFGKLADPAGTAGMIANAGWPAAT
FT                   ALAYLAGLFELVAGLAVLVGFQTRIASYLLAAFCLVTAFVFHSGPINVPDFPAAANGLL
FT                   SMFNQIMMMKNITLAGAFLVLAGFGPGALSLDARLGRTVAA"
     MPLNVIVLVG RVLLSIMFIT SGFGKLADPA GTAGMIANAG WPAATALAYL AGLFELVAGL        60
     AVLVGFQTRI ASYLLAAFCL VTAFVFHSGP INVPDFPAAA NGLLSMFNQI MMMKNITLAG       120
     AFLVLAGFGP GALSLDARLG RTVAA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page