(data stored in ACNUC7421 zone)

EMBL: CP001389.PE106

CP001389.PE106       Location/Qualifiers
FT   CDS             115492..115758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01070"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-12b"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23910"
FT                   /db_xref="GOA:C3MF73"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF73"
FT                   /protein_id="ACP23910.1"
FT                   /translation="MPDHVHMLISIPPKYSVSHIVGFLKGKTALYVANKYARKRRYKGY
FT                   HFWARGYFVSTAGYDEQVVRRYIRNQEKADKASDFADLFNRSY"
     MPDHVHMLIS IPPKYSVSHI VGFLKGKTAL YVANKYARKR RYKGYHFWAR GYFVSTAGYD        60
     EQVVRRYIRN QEKADKASDF ADLFNRSY                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page