(data stored in ACNUC7421 zone)

EMBL: CP001389.PE107

CP001389.PE107       Location/Qualifiers
FT   CDS             complement(115845..116273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01080"
FT                   /product="putative RbsD/FucU transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23911"
FT                   /db_xref="GOA:C3MF74"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF74"
FT                   /protein_id="ACP23911.1"
FT                   /translation="MLKGIDPILSPELLAALRAMGHGDEIALVDGNYPGQEHARRLVRL
FT                   DGHHLIPALDAILSVLPIDDFVPEAIFRATVKQDKDALDPVHRDIIACCRKHEPNQPVV
FT                   PLLGTEFYPRVRAAHTVVQTSEPRLYGNVILRKGVVYP"
     MLKGIDPILS PELLAALRAM GHGDEIALVD GNYPGQEHAR RLVRLDGHHL IPALDAILSV        60
     LPIDDFVPEA IFRATVKQDK DALDPVHRDI IACCRKHEPN QPVVPLLGTE FYPRVRAAHT       120
     VVQTSEPRLY GNVILRKGVV YP                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page