(data stored in ACNUC7421 zone)

EMBL: CP001389.PE108

CP001389.PE108       Location/Qualifiers
FT   CDS             complement(116274..117506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01090"
FT                   /product="putative ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23912"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF75"
FT                   /protein_id="ACP23912.1"
FT                   /translation="MSLTEDPHGGSAQPDVIDPSGGANQTRVRAYNERLVMSLVRRHGS
FT                   LSKAEIARRSGLSAQTVSVIMRALEADGMLIRGAPVRGRVGQPSIPMRLNPDAVYSFGV
FT                   KIGRRSADLVLMDFLGNIRLHLHQIHTYPLPGDLVTFIVKGIEKLEEKLGPEERKRIAG
FT                   VGIATPFELWNWAEEVGAPHEEMDKWHDFDLQAAVAARTRHPVFLQNDGTSACGAELAF
FT                   GVGASYPDFVYFYIGSFIGGGVVLNSALFSGRTGTAGAVGPLPVSGKDGKTTQLLKIAS
FT                   VFVLEKLLRERGMDPKPLWYSADDWIDFGEPLEVWIQDSAAALAQAVVSAVSIVDFSAA
FT                   VIDGGFPPWVRARLLTATRKALQTLDLQGVTLPDLVEGVVGSHARAIGGASLPLFSRYL
FT                   LDTNVLFKELT"
     MSLTEDPHGG SAQPDVIDPS GGANQTRVRA YNERLVMSLV RRHGSLSKAE IARRSGLSAQ        60
     TVSVIMRALE ADGMLIRGAP VRGRVGQPSI PMRLNPDAVY SFGVKIGRRS ADLVLMDFLG       120
     NIRLHLHQIH TYPLPGDLVT FIVKGIEKLE EKLGPEERKR IAGVGIATPF ELWNWAEEVG       180
     APHEEMDKWH DFDLQAAVAA RTRHPVFLQN DGTSACGAEL AFGVGASYPD FVYFYIGSFI       240
     GGGVVLNSAL FSGRTGTAGA VGPLPVSGKD GKTTQLLKIA SVFVLEKLLR ERGMDPKPLW       300
     YSADDWIDFG EPLEVWIQDS AAALAQAVVS AVSIVDFSAA VIDGGFPPWV RARLLTATRK       360
     ALQTLDLQGV TLPDLVEGVV GSHARAIGGA SLPLFSRYLL DTNVLFKELT                  410
//

If you have problems or comments...

PBIL Back to PBIL home page