(data stored in ACNUC7421 zone)

EMBL: CP001389.PE109

CP001389.PE109       Location/Qualifiers
FT   CDS             117773..118798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01100"
FT                   /product="periplasmic binding protein/LacI
FT                   transcriptionalregulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23913"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF76"
FT                   /protein_id="ACP23913.1"
FT                   /translation="MKKTVLSTAFGALALGVAFASPSQAADVSACLITKTDTNPFFVKM
FT                   KEGASAKAQELGVTLKAYAGKVDGDHDSQVAAIESCIADGAKGILIAASDTKAIVDQVK
FT                   KAQAAGVLVIALDTPLDPATAADATFATDNLLAGKLIGQWAAATMGENAKTAKIGFLDL
FT                   TPSQPTVDVLRDQGFMIGFGIDPKDPNKIGDEDDPRIVGHDVTNGNEEGGRTAMENLLQ
FT                   KDPDINVIHTINEPAAVGAYQALKAVGKEKDVLIVSVDGGCPGVKSVTEGVIGATSQQY
FT                   PLMMAALGIEAIKKFAETGEKPKPTEGKDFFDTGVALVTDKPAAGVESIDTKVGTEKCW
FT                   G"
     MKKTVLSTAF GALALGVAFA SPSQAADVSA CLITKTDTNP FFVKMKEGAS AKAQELGVTL        60
     KAYAGKVDGD HDSQVAAIES CIADGAKGIL IAASDTKAIV DQVKKAQAAG VLVIALDTPL       120
     DPATAADATF ATDNLLAGKL IGQWAAATMG ENAKTAKIGF LDLTPSQPTV DVLRDQGFMI       180
     GFGIDPKDPN KIGDEDDPRI VGHDVTNGNE EGGRTAMENL LQKDPDINVI HTINEPAAVG       240
     AYQALKAVGK EKDVLIVSVD GGCPGVKSVT EGVIGATSQQ YPLMMAALGI EAIKKFAETG       300
     EKPKPTEGKD FFDTGVALVT DKPAAGVESI DTKVGTEKCW G                           341
//

If you have problems or comments...

PBIL Back to PBIL home page