(data stored in ACNUC7421 zone)

EMBL: CP001389.PE111

CP001389.PE111       Location/Qualifiers
FT   CDS             120184..120966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01120"
FT                   /product="predicted sugar ABC transporter, ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23915"
FT                   /db_xref="GOA:C3MF78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF78"
FT                   /protein_id="ACP23915.1"
FT                   /translation="MAQEPILTARGLVKRYGRVTALDHADFDLYPGEILAVIGDNGAGK
FT                   SSMIKAISGAVTPDEGEIRLEGQPVHFRSPMDARAAGIETVYQNLALSPALSIADNMFL
FT                   GREIRKPGIMGKLFRTLDRSAMEKRAREKLSELGLMTIQNINQAVETLSGGQRQGVAVA
FT                   RAAAFGSKVVIMDEPTAALGVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIH
FT                   VHRLGRRLCVINPKEYTMSDAVAFMTGAKAPPGEALAA"
     MAQEPILTAR GLVKRYGRVT ALDHADFDLY PGEILAVIGD NGAGKSSMIK AISGAVTPDE        60
     GEIRLEGQPV HFRSPMDARA AGIETVYQNL ALSPALSIAD NMFLGREIRK PGIMGKLFRT       120
     LDRSAMEKRA REKLSELGLM TIQNINQAVE TLSGGQRQGV AVARAAAFGS KVVIMDEPTA       180
     ALGVKESRRV LELILDVRRR GLPIVLISHN MPHVFEVADR IHVHRLGRRL CVINPKEYTM       240
     SDAVAFMTGA KAPPGEALAA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page