(data stored in ACNUC7421 zone)

EMBL: CP001389.PE112

CP001389.PE112       Location/Qualifiers
FT   CDS             120963..121583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01130"
FT                   /product="conserved hypothetical protein contains uridine
FT                   kinase related domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23916"
FT                   /db_xref="GOA:C3MF79"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF79"
FT                   /protein_id="ACP23916.1"
FT                   /translation="MNVQSLTDEILKRAAGAGRFIVAIAGPPGAGKSTLSEALAAAIAE
FT                   TGENVAVLPMDGFHMDNAVLVEKGLLQRKGAPETFDVRAFLSTLAAVRANDGEVLVPVF
FT                   DRTRELAIASARTIAAETRIVLVEGNYLLLDEVPWSGLDGAFDYSIFIDPGIDVLEQRL
FT                   LQRWHDHGYDEETARTKAFDNDIPNARRVVGSRRASDLVIRDF"
     MNVQSLTDEI LKRAAGAGRF IVAIAGPPGA GKSTLSEALA AAIAETGENV AVLPMDGFHM        60
     DNAVLVEKGL LQRKGAPETF DVRAFLSTLA AVRANDGEVL VPVFDRTREL AIASARTIAA       120
     ETRIVLVEGN YLLLDEVPWS GLDGAFDYSI FIDPGIDVLE QRLLQRWHDH GYDEETARTK       180
     AFDNDIPNAR RVVGSRRASD LVIRDF                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page