(data stored in ACNUC7421 zone)

EMBL: CP001389.PE115

CP001389.PE115       Location/Qualifiers
FT   CDS             123551..124477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01160"
FT                   /product="fructokinase protein"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23919"
FT                   /db_xref="GOA:C3MF82"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF82"
FT                   /protein_id="ACP23919.1"
FT                   /translation="MIVCCGEALIDMLPRETAAGESAFAPYAGGAIFNTAIALGRLGIP
FT                   TGFFTGLSDDMFGDILRETLKAANVDFGPCATLPLHTTLAFVKLVHGHASYAFFDENTA
FT                   GRMITTEHLPALGDFCEALHFGAISLIPEPCGSTYEALMTREHEKRVISFDPNIRPGFI
FT                   TDREAHLARMNRMAAMSDIIKFSDEDLAWFGMEGSHDALAAEWLKRGPKLVLITRGADG
FT                   AVGYTKNHKVEVASERVTVVDTVGAGDTFDAGVLAALKLNNLLTKEQVANLSDEAVRQA
FT                   LALGAKAAAVTVSRAGANPPWKYEIGL"
     MIVCCGEALI DMLPRETAAG ESAFAPYAGG AIFNTAIALG RLGIPTGFFT GLSDDMFGDI        60
     LRETLKAANV DFGPCATLPL HTTLAFVKLV HGHASYAFFD ENTAGRMITT EHLPALGDFC       120
     EALHFGAISL IPEPCGSTYE ALMTREHEKR VISFDPNIRP GFITDREAHL ARMNRMAAMS       180
     DIIKFSDEDL AWFGMEGSHD ALAAEWLKRG PKLVLITRGA DGAVGYTKNH KVEVASERVT       240
     VVDTVGAGDT FDAGVLAALK LNNLLTKEQV ANLSDEAVRQ ALALGAKAAA VTVSRAGANP       300
     PWKYEIGL                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page