(data stored in ACNUC7421 zone)

EMBL: CP001389.PE118

CP001389.PE118       Location/Qualifiers
FT   CDS             128845..130020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01190"
FT                   /product="predicted transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23922"
FT                   /db_xref="GOA:C3MF85"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF85"
FT                   /protein_id="ACP23922.1"
FT                   /translation="MQLGNRERENPPVEPRLFGQPAHSRSALVLPISAARWMLVLILLA
FT                   GVYFFHGFVVPVLAAVVIGFASWPIYRRLLQALNGNRTLAATIAIISVIAFIVVPISIA
FT                   AAYAIDEVRDWLVWAVETNVNGAPVPAWLTTIPVAGAWLGQQWVKYVGHPGALGELVQL
FT                   VSGSNIGNIYRGVLVIGASAFQSFLTLLFMLITLFFVYRDGHSFSKQLDRLGEQIFPMR
FT                   WERLSRVVPLTISSTVTGMGIIAIGEGIVLGVAYWLAGVPSPVTLGIITGLMALIPGGA
FT                   PLCFTLVSIYLVASGSPFHGVALFAWGTTELFIVDKTLRPRLVGGPIKLPFLPTFFGLV
FT                   GGVKTMGFLGLFVGPVLMALLVAIWREWMHEVANQPEPTANPISRVDIAAK"
     MQLGNREREN PPVEPRLFGQ PAHSRSALVL PISAARWMLV LILLAGVYFF HGFVVPVLAA        60
     VVIGFASWPI YRRLLQALNG NRTLAATIAI ISVIAFIVVP ISIAAAYAID EVRDWLVWAV       120
     ETNVNGAPVP AWLTTIPVAG AWLGQQWVKY VGHPGALGEL VQLVSGSNIG NIYRGVLVIG       180
     ASAFQSFLTL LFMLITLFFV YRDGHSFSKQ LDRLGEQIFP MRWERLSRVV PLTISSTVTG       240
     MGIIAIGEGI VLGVAYWLAG VPSPVTLGII TGLMALIPGG APLCFTLVSI YLVASGSPFH       300
     GVALFAWGTT ELFIVDKTLR PRLVGGPIKL PFLPTFFGLV GGVKTMGFLG LFVGPVLMAL       360
     LVAIWREWMH EVANQPEPTA NPISRVDIAA K                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page