(data stored in ACNUC7421 zone)

EMBL: CP001389.PE119

CP001389.PE119       Location/Qualifiers
FT   CDS             130126..132810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01200"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23923"
FT                   /db_xref="GOA:C3MF86"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF86"
FT                   /protein_id="ACP23923.1"
FT                   /translation="MPEIDRDPASRPDPDALLALAEKGGRGKLTVFLGAAPGVGKTYAM
FT                   LMRAQRLKEEGADIVIGLVETHGRSETAALLEGLEVLPRREVAHGGRTLHEFDLDAALA
FT                   RHPRIIVVDELAHTNFGESRHPKRYQDIEELVDAGIDVWTALNIQHLESLSDIVAQIAG
FT                   VPVRERIPDTVLNRADEVLLVDLPPAELIDRLKEGKVYLPDSAKRAVDNFFRLGNLTAL
FT                   RELALRRTADRVDDQMVDYLKQNAIEGPWPASERLLVCIGPDPLSEKVVRTASRLASGL
FT                   NADWIVVSVERADREAADGEAMRQLDETFRLAEQLGAETRRIIGSDFVEEILKLARREN
FT                   ATQIVIGARRHRFPLNLFRASLPDALAKRVSGIGIHLVTGKIEPVARTRRRSKQLLPEG
FT                   LERALAIAGGTVGLATVLGLLIEQFIILQNISLLYLLAVLASAVYAGYFAALAAALFSV
FT                   VAYNFFFIEPVNTFTVAEPHEVFALFVFLAAAALAGGLASRIREQAKTARNRATATQAL
FT                   YDFSRKLSGTANADDVLWAAVTQMQSTLRRNAVMLLPEDGDIALRAAWPPDTELTVSDM
FT                   IAARWAFEKKEAAGNDTGTLPNSPFQFRPLMSPQGVVGVCGFLQEDSPLEINEERALAA
FT                   ILDQTAIAVDRARLSRESLDQAAQLEGEKFRAALLSSLSHDLTTPLATIGSAVISLRQL
FT                   GEGTPKDAREDLLKSIEEESGRLTRFVTNLLDMNRIEAGTINARRDRVDVAEVVHDAVE
FT                   RARKYFPGRVFETSIALGLPAMRGDGVLLGQVLFNLLDNANRFGGDEPVSIYARREGDE
FT                   VVLSVTDLGKGIAPADLEHVFDKFFRKGKPDGRSLGTGLGLTISRSFVEAMGGRIKAES
FT                   PALRRRGTRISMRFPAAEAELSN"
     MPEIDRDPAS RPDPDALLAL AEKGGRGKLT VFLGAAPGVG KTYAMLMRAQ RLKEEGADIV        60
     IGLVETHGRS ETAALLEGLE VLPRREVAHG GRTLHEFDLD AALARHPRII VVDELAHTNF       120
     GESRHPKRYQ DIEELVDAGI DVWTALNIQH LESLSDIVAQ IAGVPVRERI PDTVLNRADE       180
     VLLVDLPPAE LIDRLKEGKV YLPDSAKRAV DNFFRLGNLT ALRELALRRT ADRVDDQMVD       240
     YLKQNAIEGP WPASERLLVC IGPDPLSEKV VRTASRLASG LNADWIVVSV ERADREAADG       300
     EAMRQLDETF RLAEQLGAET RRIIGSDFVE EILKLARREN ATQIVIGARR HRFPLNLFRA       360
     SLPDALAKRV SGIGIHLVTG KIEPVARTRR RSKQLLPEGL ERALAIAGGT VGLATVLGLL       420
     IEQFIILQNI SLLYLLAVLA SAVYAGYFAA LAAALFSVVA YNFFFIEPVN TFTVAEPHEV       480
     FALFVFLAAA ALAGGLASRI REQAKTARNR ATATQALYDF SRKLSGTANA DDVLWAAVTQ       540
     MQSTLRRNAV MLLPEDGDIA LRAAWPPDTE LTVSDMIAAR WAFEKKEAAG NDTGTLPNSP       600
     FQFRPLMSPQ GVVGVCGFLQ EDSPLEINEE RALAAILDQT AIAVDRARLS RESLDQAAQL       660
     EGEKFRAALL SSLSHDLTTP LATIGSAVIS LRQLGEGTPK DAREDLLKSI EEESGRLTRF       720
     VTNLLDMNRI EAGTINARRD RVDVAEVVHD AVERARKYFP GRVFETSIAL GLPAMRGDGV       780
     LLGQVLFNLL DNANRFGGDE PVSIYARREG DEVVLSVTDL GKGIAPADLE HVFDKFFRKG       840
     KPDGRSLGTG LGLTISRSFV EAMGGRIKAE SPALRRRGTR ISMRFPAAEA ELSN             894
//

If you have problems or comments...

PBIL Back to PBIL home page