(data stored in ACNUC7421 zone)

EMBL: CP001389.PE125

CP001389.PE125       Location/Qualifiers
FT   CDS             137338..138546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01260"
FT                   /product="phage integrase-like protein contains catalytic
FT                   core domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23929"
FT                   /db_xref="GOA:C3MF92"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF92"
FT                   /protein_id="ACP23929.1"
FT                   /translation="MARPLNKLTAVAVKNASAGKHSDGGGLWLHKREDGGSQWILRVNV
FT                   HGRRREMGLGSASDVSLKEAREAAERWRALVRSGLDPIKERQRQRREAARNLHCLDDIA
FT                   RDAFESRKAELKGDGIAGRWFSPLEIHVLPKLGKVPVVDIDQTDIRDVLAPIWHSKAET
FT                   ARKALNRLAICLKHAAALGLDVDLQATDKARALLGKQRHKIENIPAMPWQDVPGFFASL
FT                   SDGSVTHLALRLLILTGVRSGPLRFLRDEQINGDVWTIPGEAMKGRKGATADFRVPLSD
FT                   AALAVVEQARQHARDGFLFPSLRKGVISDATMSRLMERAGMEARPHGFRSSLRDWIAEA
FT                   TDTPHDIAETTLGHIVGGAVERAYRRTDFLEQRRQLMARWARHVTGQSGQVITLAKRNH
FT                   SEP"
     MARPLNKLTA VAVKNASAGK HSDGGGLWLH KREDGGSQWI LRVNVHGRRR EMGLGSASDV        60
     SLKEAREAAE RWRALVRSGL DPIKERQRQR REAARNLHCL DDIARDAFES RKAELKGDGI       120
     AGRWFSPLEI HVLPKLGKVP VVDIDQTDIR DVLAPIWHSK AETARKALNR LAICLKHAAA       180
     LGLDVDLQAT DKARALLGKQ RHKIENIPAM PWQDVPGFFA SLSDGSVTHL ALRLLILTGV       240
     RSGPLRFLRD EQINGDVWTI PGEAMKGRKG ATADFRVPLS DAALAVVEQA RQHARDGFLF       300
     PSLRKGVISD ATMSRLMERA GMEARPHGFR SSLRDWIAEA TDTPHDIAET TLGHIVGGAV       360
     ERAYRRTDFL EQRRQLMARW ARHVTGQSGQ VITLAKRNHS EP                          402
//

If you have problems or comments...

PBIL Back to PBIL home page