(data stored in ACNUC7421 zone)

EMBL: CP001389.PE126

CP001389.PE126       Location/Qualifiers
FT   CDS             138536..139396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23930"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF93"
FT                   /protein_id="ACP23930.1"
FT                   /translation="MNREFDKAMEAWRLPDELSVVDAAILITGNDPSAEHEVYDHKMRR
FT                   AFLEQVTTGHRGFEAAFSALRSAILANKLQARVVFSVDVERAELRAVVRGSRQISELSG
FT                   QLLSHCADAVSLQWEPDWKQTTVEVKELRRWLESRNHRPPFFFPTTETQPEPRPKVRDF
FT                   MDRTHLRYSAKLACAVAAWEALADLPKSKAVKDAICDWVAEHGERYAKPGDRNGFGAAG
FT                   KVTGSALDQIASVVNWKPQGGAPRTGGEVSGKSGQVPNSGVGPARQDQKMQPLDDEGGE
FT                   EPPFL"
     MNREFDKAME AWRLPDELSV VDAAILITGN DPSAEHEVYD HKMRRAFLEQ VTTGHRGFEA        60
     AFSALRSAIL ANKLQARVVF SVDVERAELR AVVRGSRQIS ELSGQLLSHC ADAVSLQWEP       120
     DWKQTTVEVK ELRRWLESRN HRPPFFFPTT ETQPEPRPKV RDFMDRTHLR YSAKLACAVA       180
     AWEALADLPK SKAVKDAICD WVAEHGERYA KPGDRNGFGA AGKVTGSALD QIASVVNWKP       240
     QGGAPRTGGE VSGKSGQVPN SGVGPARQDQ KMQPLDDEGG EEPPFL                      286
//

If you have problems or comments...

PBIL Back to PBIL home page