(data stored in ACNUC7421 zone)

EMBL: CP001389.PE128

CP001389.PE128       Location/Qualifiers
FT   CDS             139921..140214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23932"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF95"
FT                   /protein_id="ACP23932.1"
FT                   /translation="MSKVFLTIRRLPDGAPHTMRGRPAWALELLIDAGSAGCTPITDPG
FT                   PRWSSYVHILRKRSGLVIDTLRETHDGQFPGTHARYVLRSPVEVLRSWRDVK"
     MSKVFLTIRR LPDGAPHTMR GRPAWALELL IDAGSAGCTP ITDPGPRWSS YVHILRKRSG        60
     LVIDTLRETH DGQFPGTHAR YVLRSPVEVL RSWRDVK                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page