(data stored in ACNUC7421 zone)

EMBL: CP001389.PE129

CP001389.PE129       Location/Qualifiers
FT   CDS             140324..140821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23933"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF96"
FT                   /protein_id="ACP23933.1"
FT                   /translation="MTNINLRDHSHTSGRAEKKPRWLTQFIGHRLEMLLSPAWQDAPRP
FT                   LARLIERLEIEHLRHGGQNNGELYVSYAQFAAYGISKRVICRTLKLGEDLGLIEVIRGE
FT                   GIIRGDIRPENAYRLTFVPAKNRKSPTDEWKQISKARAKDLVTAYRADEKRATNTARRA
FT                   AA"
     MTNINLRDHS HTSGRAEKKP RWLTQFIGHR LEMLLSPAWQ DAPRPLARLI ERLEIEHLRH        60
     GGQNNGELYV SYAQFAAYGI SKRVICRTLK LGEDLGLIEV IRGEGIIRGD IRPENAYRLT       120
     FVPAKNRKSP TDEWKQISKA RAKDLVTAYR ADEKRATNTA RRAAA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page