(data stored in ACNUC7421 zone)

EMBL: CP001389.PE130

CP001389.PE130       Location/Qualifiers
FT   CDS             complement(142074..142328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23934"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF97"
FT                   /protein_id="ACP23934.1"
FT                   /translation="MSVEPEYDPDWDSPEAIAKWRVRGIRNIYERAKEFHRIKAELEME
FT                   ISTARETLVRKPLMREDEIEAATQRAYDALQDRKAKDQS"
     MSVEPEYDPD WDSPEAIAKW RVRGIRNIYE RAKEFHRIKA ELEMEISTAR ETLVRKPLMR        60
     EDEIEAATQR AYDALQDRKA KDQS                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page