(data stored in ACNUC7421 zone)

EMBL: CP001389.PE131

CP001389.PE131       Location/Qualifiers
FT   CDS             complement(142330..142854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23935"
FT                   /db_xref="GOA:C3MF98"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF98"
FT                   /protein_id="ACP23935.1"
FT                   /translation="MNEKLAPFVLVSQPTSLRRHWLVYVSAVFFGLIACAAIQQSWGEG
FT                   LGAILIPAAIGYFVVKGGKSVPGLLVRYSIFMLGFMFVISGLAISEITEAHDGVKTSCL
FT                   TKNDYTAQLTTEKRTQYCQCMSDTLDAAIVWSTSTSFLAFKPLTGKIQDVPELMNLATK
FT                   RANECAVQMGG"
     MNEKLAPFVL VSQPTSLRRH WLVYVSAVFF GLIACAAIQQ SWGEGLGAIL IPAAIGYFVV        60
     KGGKSVPGLL VRYSIFMLGF MFVISGLAIS EITEAHDGVK TSCLTKNDYT AQLTTEKRTQ       120
     YCQCMSDTLD AAIVWSTSTS FLAFKPLTGK IQDVPELMNL ATKRANECAV QMGG             174
//

If you have problems or comments...

PBIL Back to PBIL home page