(data stored in ACNUC7421 zone)

EMBL: CP001389.PE132

CP001389.PE132       Location/Qualifiers
FT   CDS             143676..147098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01330"
FT                   /product="putative restriction endonuclease type I with R
FT                   subunit / type III with Res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23936"
FT                   /db_xref="GOA:C3MF99"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF99"
FT                   /protein_id="ACP23936.1"
FT                   /translation="MGGALSVNFDHLKSLSPELQRLGTLAERFFADDANTSLIKSRQFG
FT                   EYMVKEIAALSGVYDPAARETTHDLLRRLATQQILPREVADIFHAVRKSGNEATHNLAG
FT                   SPTEALAALKFCRALGVWYRRTYGRDPNFRPGPFVPPKASADIDQATQAELATLRRQVR
FT                   EAEAQLAAAHSSADELAKARAAADELARQAAADNAVWEQTAVEMEANQAELSRKLAELQ
FT                   KAAQAQPQQLQMEFKQAGLQAASRLELDERQTRRLIDAQLVDAGWEADSDRLSYQLGAR
FT                   PEEGRNLAIAEWPAAGGRADYGLFIGLTCVGIIEAKRESVDVPSTLQQAERYARTIALP
FT                   PENSHPGGLWNHGLADPFRVPFVFTTNGRPFVRQWQTKSGIWFCDLRRDTNHPRPLTTW
FT                   FSPKDLLDILATDLDAAAQGLAEDSFGKGRMRPYQEDAIAAIENAVVAGQRDILVSMAT
FT                   GTGKTRTSIALMYRLLKHKRFRRILFLVDRKALGKQTSDALETTEIEGMLNFAQIYKVA
FT                   GLEKKVPEDEDQVQVATVQSLIARILNEPDPAKRPTPGTFDCIIVDEAHRGYTLDAELR
FT                   ESDVGFRNLDDYQSAYRQILDYFDAVKVALTATPALHTREIFGHPVFHYGYRQAVVEGY
FT                   LNDHLPPKRITTALSEAGIHFEGGEEVEIIDRTTGQIDLFELPDEVSLDYDVADFNKRV
FT                   YSEAFNRMVCRAIATEIPPSKPGKTLIFAARDAHADDLVRLLVEELQEEYGNDAVPHGM
FT                   VMKITGNVDKADDLILKFKNDPHPKYVVTVDLLTTGIDVPTICNLVFVRRVKSRILYDQ
FT                   MIGRATRLCPEIGKEHFRIFDAVDLYAELQEMTDMRPVVVKPDISLGQLVTDLDKAETE
FT                   EDKSWVAGQVIVRMRAMANRMDAETRESFERHTGETPENAVQRLATLSGSELQDWLKSH
FT                   PRVIELLERRPIRTGSGNDGVVISTHEDELLRIEEIFGKNTTPEDYITGFERFIRENMN
FT                   QVPALIAVTQRPRDLTRKELSELAGLLDEKNYSEAMLRAAYGKVRNADIAAHIIGFVRQ
FT                   AAIGDPLIPYATRVENAIGKIEASRPWTQKQKEWLRRIGRALKDKPVADPTLLDQGVFA
FT                   DKGGFKRISQEFDGELDDVLHAFNEAIWAPPAA"
     MGGALSVNFD HLKSLSPELQ RLGTLAERFF ADDANTSLIK SRQFGEYMVK EIAALSGVYD        60
     PAARETTHDL LRRLATQQIL PREVADIFHA VRKSGNEATH NLAGSPTEAL AALKFCRALG       120
     VWYRRTYGRD PNFRPGPFVP PKASADIDQA TQAELATLRR QVREAEAQLA AAHSSADELA       180
     KARAAADELA RQAAADNAVW EQTAVEMEAN QAELSRKLAE LQKAAQAQPQ QLQMEFKQAG       240
     LQAASRLELD ERQTRRLIDA QLVDAGWEAD SDRLSYQLGA RPEEGRNLAI AEWPAAGGRA       300
     DYGLFIGLTC VGIIEAKRES VDVPSTLQQA ERYARTIALP PENSHPGGLW NHGLADPFRV       360
     PFVFTTNGRP FVRQWQTKSG IWFCDLRRDT NHPRPLTTWF SPKDLLDILA TDLDAAAQGL       420
     AEDSFGKGRM RPYQEDAIAA IENAVVAGQR DILVSMATGT GKTRTSIALM YRLLKHKRFR       480
     RILFLVDRKA LGKQTSDALE TTEIEGMLNF AQIYKVAGLE KKVPEDEDQV QVATVQSLIA       540
     RILNEPDPAK RPTPGTFDCI IVDEAHRGYT LDAELRESDV GFRNLDDYQS AYRQILDYFD       600
     AVKVALTATP ALHTREIFGH PVFHYGYRQA VVEGYLNDHL PPKRITTALS EAGIHFEGGE       660
     EVEIIDRTTG QIDLFELPDE VSLDYDVADF NKRVYSEAFN RMVCRAIATE IPPSKPGKTL       720
     IFAARDAHAD DLVRLLVEEL QEEYGNDAVP HGMVMKITGN VDKADDLILK FKNDPHPKYV       780
     VTVDLLTTGI DVPTICNLVF VRRVKSRILY DQMIGRATRL CPEIGKEHFR IFDAVDLYAE       840
     LQEMTDMRPV VVKPDISLGQ LVTDLDKAET EEDKSWVAGQ VIVRMRAMAN RMDAETRESF       900
     ERHTGETPEN AVQRLATLSG SELQDWLKSH PRVIELLERR PIRTGSGNDG VVISTHEDEL       960
     LRIEEIFGKN TTPEDYITGF ERFIRENMNQ VPALIAVTQR PRDLTRKELS ELAGLLDEKN      1020
     YSEAMLRAAY GKVRNADIAA HIIGFVRQAA IGDPLIPYAT RVENAIGKIE ASRPWTQKQK      1080
     EWLRRIGRAL KDKPVADPTL LDQGVFADKG GFKRISQEFD GELDDVLHAF NEAIWAPPAA      1140
//

If you have problems or comments...

PBIL Back to PBIL home page